KEGG   Homo sapiens (human): 83862Help
Entry
83862             CDS       T01001                                 

Gene name
TMEM120A, NET29, TMPIT
Definition
(RefSeq) transmembrane protein 120A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TMPIT STAT_alpha Seryl_tRNA_N
Motif
Other DBs
NCBI-GeneID: 83862
NCBI-ProteinID: NP_114131
OMIM: 616550
HGNC: 21697
Ensembl: ENSG00000189077
Vega: OTTHUMG00000156620
Pharos: Q9BXJ8(Tdark)
UniProt: Q9BXJ8
Position
7q11.23
AA seq 343 aa AA seqDB search
MQPPPPGPLGDCLRDWEDLQQDFQNIQETHRLYRLKLEELTKLQNNCTSSITRQKKRLQE
LALALKKCKPSLPAEAEGAAQELENQMKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL
LSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES
ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY
QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLAQDP
QCKEWQVLMCGFPFLLLFLGNFFTTLRVVHHKFHSQRHGSKKD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccccgcccccgggcccgctgggcgactgcctgcgggactgggaggatctacag
caggacttccagaacatccaggagacccatcggctctaccgcctgaagctggaggagctg
accaaacttcagaacaattgcaccagctccatcacgcggcagaagaagcggctccaggag
ctggccctcgccctgaagaaatgcaaaccctccctcccagcagaggccgagggggccgca
caggagctggagaaccagatgaaagagcgccaaggcctcttctttgacatggaggcctat
ttgcctaagaagaatggattgtacctgagcctggttctggggaacgtcaacgtcacgctc
ctgagcaagcaggctaagtttgcctacaaggacgagtatgagaagttcaagctctacctc
accatcatcctcatcctcatctccttcacttgccgcttcctgctcaactccagggtgaca
gatgctgccttcaacttcctgctggtctggtactactgcaccctgaccatccgggagagc
atcctcatcaacaacggctcccggatcaaaggctggtgggtgttccatcactacgtgtcc
accttcctgtcgggagtcatgctgacgtggcccgacggtctcatgtaccagaaattccgg
aaccaattcctctccttttccatgtaccagagcttcgtgcagtttctccagtactactac
cagagcggctgcctctaccgcctgcgggcgctgggcgagcggcacaccatggacctcact
gtggagggcttccagtcctggatgtggcggggcctcaccttcctgctgccttttcttttc
tttggacacttctggcagctttttaacgcgctgacgttgttcaacctggcccaggaccct
cagtgcaaggagtggcaggtgcttatgtgcggctttcccttcctcctccttttcctcggc
aatttcttcaccaccctgagggttgtgcaccacaagtttcacagtcagcggcacgggagc
aagaaggattga

DBGET integrated database retrieval system