KEGG   Homo sapiens (human): 8387
Entry
8387              CDS       T01001                                 

Gene name
OR1E1, HGM071, OR13-66, OR17-2, OR17-32, OR1E5, OR1E6, OR1E8P, OR1E9P, OST547
Definition
(RefSeq) olfactory receptor family 1 subfamily E member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    8387 (OR1E1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8387 (OR1E1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    8387 (OR1E1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1757
Other DBs
NCBI-GeneID: 8387
NCBI-ProteinID: NP_003544
HGNC: 8189
Ensembl: ENSG00000180016
Vega: OTTHUMG00000090643
Pharos: P30953(Tdark)
UniProt: P30953
Position
17p13.3
AA seq 314 aa
MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY
LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY
DRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD
MSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFST
CGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA
LSRVIHQKKTFFSL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgatgggacaaaatcaaaccagcatctcagacttcctgctcctgggcctgcccatccaa
ccagagcagcaaaacctgtgctatgccctgttcttggccatgtatcttaccaccctcctg
gggaacctcctcatcattgtcctcattcgactggactcccatctccacacgcctatgtat
ttgtttctcagcaacttgtccttctctgacctctgcttctcttccgtgaccattcccaag
ttgttacagaacatgcagaaccaggacccatccatcccctatgcggactgcctgacccaa
atgtacttcttcctgttatttggagacctggagagcttcctccttgtggccatggcctat
gaccgctatgtggccatctgcttccccctgcactacaccgccatcatgagccccatgctc
tgtctcgccctggtggcgctgtcctgggtgctgaccaccttccatgccatgttacacact
ttactcatggccaggttgtgtttttgtgcagacaatgtgatcccccactttttctgtgat
atgtctgctctgctgaagctggccttctctgacactcgagttaatgaatgggtgatattt
atcatgggagggctcattcttgtcatcccattcctactcatccttgggtcctatgcaaga
attgtctcctccatcctcaaggtcccttcttctaagggtatctgcaaggccttctctact
tgtggctcccacctgtctgtggtgtcactgttctatggaaccgttattggtctctactta
tgctcatcagctaatagttctactctaaaggacactgtcatggctatgatgtacactgtg
gtgacccccatgctgaaccccttcatctacagcctgaggaacagagacatgaagggagcc
ctgagcagagtcattcatcagaagaaaactttcttctctctctga

DBGET integrated database retrieval system