KEGG   Homo sapiens (human): 83873
Entry
83873             CDS       T01001                                 

Gene name
GPR61, BALGR, GPCR3
Definition
(RefSeq) G protein-coupled receptor 61
  KO
K08414  G protein-coupled receptor 61
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    83873 (GPR61)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    83873 (GPR61)
SSDB
Motif
Pfam: 7tm_1 7tm_4 Pex24p
Other DBs
NCBI-GeneID: 83873
NCBI-ProteinID: NP_114142
OMIM: 606916
HGNC: 13300
Ensembl: ENSG00000156097
Vega: OTTHUMG00000011633
Pharos: Q9BZJ8(Tbio)
UniProt: Q9BZJ8 G4XH66
Position
1p13.3
AA seq 451 aa
MESSPIPQSSGNSSTLGRVPQTPGPSTASGVPEVGLRDVASESVALFFMLLLDLTAVAGN
AAVMAVIAKTPALRKFVFVFHLCLVDLLAALTLMPLAMLSSSALFDHALFGEVACRLYLF
LSVCFVSLAILSVSAINVERYYYVVHPMRYEVRMTLGLVASVLVGVWVKALAMASVPVLG
RVSWEEGAPSVPPGCSLQWSHSAYCQLFVVVFAVLYFLLPLLLILVVYCSMFRVARVAAM
QHGPLPTWMETPRQRSESLSSRSTMVTSSGAPQTTPHRTFGGGKAAVVLLAVGGQFLLCW
LPYFSFHLYVALSAQPISTGQVESVVTWIGYFCFTSNPFFYGCLNRQIRGELSKQFVCFF
KPAPEEELRLPSREGSIEENFLQFLQGTGCPSESWVSRPLPSPKQEPPAVDFRIPGQIAE
ETSEFLEQQLTSDIIMSDSYLRPAASPRLES
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggagtcctcacccatcccccagtcatcagggaactcttccactttggggagggtccct
caaaccccaggtccctctactgccagtggggtcccggaggtggggctacgggatgttgct
tcggaatctgtggccctcttcttcatgctcctgctggacttgactgctgtggctggcaat
gccgctgtgatggccgtgatcgccaagacgcctgccctccgaaaatttgtcttcgtcttc
cacctctgcctggtggacctgctggctgccctgaccctcatgcccctggccatgctctcc
agctctgccctctttgaccacgccctctttggggaggtggcctgccgcctctacttgttt
ctgagcgtgtgctttgtcagcctggccatcctctcggtgtcagccatcaatgtggagcgc
tactattacgtagtccaccccatgcgctacgaggtgcgcatgacgctggggctggtggcc
tctgtgctggtgggtgtgtgggtgaaggccttggccatggcttctgtgccagtgttggga
agggtctcctgggaggaaggagctcccagtgtccccccaggctgttcactccagtggagc
cacagtgcctactgccagctttttgtggtggtctttgctgtcctttactttctgttgccc
ctgctcctcatacttgtggtctactgcagcatgttccgagtggcccgcgtggctgccatg
cagcacgggccgctgcccacgtggatggagacaccccggcaacgctccgaatctctcagc
agccgctccacgatggtcaccagctcgggggccccccagaccaccccacaccggacgttt
gggggagggaaagcagcagtggttctcctggctgtggggggacagttcctgctctgttgg
ttgccctacttctctttccacctctatgttgccctgagtgctcagcccatttcaactggg
caggtggagagtgtggtcacctggattggctacttttgcttcacttccaaccctttcttc
tatggatgtctcaaccggcagatccggggggagctcagcaagcagtttgtctgcttcttc
aagccagctccagaggaggagctgaggctgcctagccgggagggctccattgaggagaac
ttcctgcagttccttcaggggactggctgtccttctgagtcctgggtttcccgaccccta
cccagccccaagcaggagccacctgctgttgactttcgaatcccaggccagatagctgag
gagacctctgagttcctggagcagcaactcaccagcgacatcatcatgtcagacagctac
ctccgtcctgccgcctcaccccggctggagtcatga

DBGET integrated database retrieval system