KEGG   Homo sapiens (human): 83874
Entry
83874             CDS       T01001                                 

Gene name
TBC1D10A, EPI64, TBC1D10, dJ130H16.1, dJ130H16.2
Definition
(RefSeq) TBC1 domain family member 10A
  KO
K19944  TBC1 domain family member 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    83874 (TBC1D10A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    83874 (TBC1D10A)
SSDB
Motif
Pfam: RabGAP-TBC TonB_N
Other DBs
NCBI-GeneID: 83874
NCBI-ProteinID: NP_114143
OMIM: 610020
HGNC: 23609
Ensembl: ENSG00000099992
Vega: OTTHUMG00000150924
Pharos: Q9BXI6(Tbio)
UniProt: Q9BXI6 A7E244 B7ZVY9
Position
22q12.2
AA seq 508 aa
MAKSNGENGPRAPAAGESLSGTRESLAQGPDAATTDELSSLGSDSEANGFAERRIDKFGF
IVGSQGAEGALEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKIRLRCQKGIPPSLRGRA
WQYLSGGKVKLQQNPGKFDELDMSPGDPKWLDVIERDLHRQFPFHEMFVSRGGHGQQDLF
RVLKAYTLYRPEEGYCQAQAPIAAVLLMHMPAEQAFWCLVQICEKYLPGYYSEKLEAIQL
DGEILFSLLQKVSPVAHKHLSRQKIDPLLYMTEWFMCAFSRTLPWSSVLRVWDMFFCEGV
KIIFRVGLVLLKHALGSPEKVKACQGQYETIERLRSLSPKIMQEAFLVQEVVELPVTERQ
IEREHLIQLRRWQETRGELQCRSPPRLHGAKAILDAEPGPRPALQPSPSIRLPLDAPLPG
SKAKPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSA
PQDLAPQVSAHHRSQESLTSQESEDTYL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggcgaagagcaacggagagaatgggccgcgcgcgcccgcggccggggaaagcctgtcg
ggaacccgggagagcctggcccagggccccgacgccgcaaccaccgacgaactcagctct
ctcgggtctgactcggaggccaacggcttcgccgagcgccgcatcgacaagttcggcttc
atcgtgggctcgcagggcgccgagggcgcgctggaggaagtacccctggaggtgctgagg
cagagggagtccaagtggctggacatgctcaacaactgggacaaatggatggccaagaag
cacaaaaagattcgtctgcggtgccaaaagggcatcccgccttctctgcggggccgtgct
tggcagtacctgtcaggaggcaaggtgaagttacagcagaaccctggaaagtttgacgag
ctggacatgtcccctggggaccccaagtggctggacgtgattgagcgtgacctgcaccgg
cagttcccattccatgagatgtttgtgtcccgggggggccacggccagcaggacctattc
cgtgtgctgaaggcctacacgctgtaccggcccgaggagggctactgccaggcccaggcg
cccattgccgctgtcttgctcatgcatatgcctgctgagcaagccttctggtgcctggta
cagatctgtgagaagtacctgcccggctactacagcgagaaactggaggcgatccagctg
gacggggagatccttttctcgctgttgcagaaggtgtcgccggtggcccacaagcacctc
agccgtcagaagatcgacccgctcctctatatgacagaatggttcatgtgcgccttctcc
cgaaccttgccctggagctctgtgctgcgtgtctgggacatgttcttctgtgaaggggtc
aagatcatcttccgggtggggctggtgctgctgaagcacgcgctgggctcccctgagaag
gtcaaagcctgccagggccagtacgagaccatcgagcgactgcggagcctcagccccaag
atcatgcaggaggcctttctggtccaggaggtggtggagttgcccgtgacagagcgccag
attgagcgcgaacacctcattcagctgcggcgctggcaggagacccggggtgagctgcag
tgccgctccccgcccaggctgcatggtgccaaggctatcttggatgcagaacctggtccc
cggcctgccctacaaccttcaccatccatccgcctgcccctagatgcccccctccctggc
tccaaagccaagcccaagccacccaagcaggcccagaaggagcagcggaaacagatgaag
gggagagggcagctggagaagcccccagccccaaatcaagccatggtggtggccgctgca
ggagatgcatgtcccccacagcatgtgcccccgaaggactcagcccccaaggactcagcc
cctcaggatttggctccccaggtctcagcccaccaccgctcccaggagagcttgacgtcc
caagagagtgaggacacctacttgtaa

DBGET integrated database retrieval system