KEGG   Homo sapiens (human): 83875
Entry
83875             CDS       T01001                                 

Gene name
BCO2, B-DIOX-II, BCDO2
Definition
(RefSeq) beta-carotene oxygenase 2
  KO
K10252  beta,beta-carotene 9',10'-dioxygenase [EC:1.13.11.71]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    83875 (BCO2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.71  carotenoid-9',10'-cleaving dioxygenase
     83875 (BCO2)
SSDB
Motif
Pfam: RPE65
Other DBs
NCBI-GeneID: 83875
NCBI-ProteinID: NP_114144
OMIM: 611740
HGNC: 18503
Ensembl: ENSG00000197580
Vega: OTTHUMG00000167155
Pharos: Q9BYV7(Tbio)
UniProt: Q9BYV7 B2RCV8
Position
11q23.1
AA seq 579 aa
MFFRVFLHFIRSHSATAVDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTT
VEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVT
YRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNV
NYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDLDGTAYNMGN
SFGPYGFSYKVIRVPPEKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQ
PLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQIN
AFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLN
APEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHF
FYGCGFRHLVGDSLIKVDVVNKTLKVWREDGFYPSEPVFVPAPGTNEEDGGVILSVVITP
NQNESNFILVLDAKNFEELGRAEVPVQMPYGFHGTFIPI
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgttttttcgagtctttctccattttatcaggagtcattctgccactgcagtggatttc
cttcctgtgatggtgcaccggctcccagttttcaaaaggtacatgggaaatactcctcag
aaaaaagccgtctttgggcagtgtcggggtctgccatgtgttgcaccgctgctgaccaca
gtggaagaggctccacggggcatctctgctcgagtctggggacattttcctaagtggctc
aatggctctctacttcgaattggacctgggaaattcgagtttgggaaggataagtacaat
cattggtttgatgggatggcgctgcttcaccagttcagaatggcaaagggcacagtgaca
tacaggagcaagtttctacagagtgatacatataaggccaacagtgctaaaaaccgaatt
gtgatctcagaatttggcacactggctctcccggatccatgcaagaatgtttttgaacgt
ttcatgtccaggtttgagctgcctggtaaagctgcagccatgactgacaatactaatgtc
aactatgtgcggtacaagggtgattactacctctgcactgagaccaactttatgaataaa
gtggacattgaaactctggaaaaaacagaaaaggtagattggagcaaatttattgctgtg
aatggagcaactgcacatcctcattatgacctggatggaacagcatacaatatggggaac
tcctttgggccatatggtttctcctataaggttattcgggttcctccagagaaggtggac
cttggggagacaatccatggagtccaggtgatatgttctattgcttctacagagaaaggg
aaaccttcttactaccatagctttggaatgacaaggaactatataattttcattgaacaa
cctctaaagatgaacctgtggaaaattgccacttctaaaattcggggaaaggccttttca
gatgggataagctgggaaccccagtgtaatacgcggtttcatgtggtggaaaaacgcact
ggacagctccttccagggagatactacagcaaaccttttgttacatttcatcaaatcaat
gcctttgaggaccagggctgtgttataattgatttgtgctgtcaagataatggaagaacc
ctagaagtttaccagttacagaatctcaggaaggctggggaagggcttgatcaggtccat
aattcagcagccaaatctttccctcgaaggtttgttttgcctttaaatgtcagtttgaat
gcccctgagggagacaacctgagtccattgtcctatacttcagccagtgctgtgaaacag
gctgatggaacgatctggtgctctcatgaaaatctacatcaggaggacctagaaaaggaa
ggaggcattgaatttcctcagatctactatgatcgattcagtggcaaaaagtatcatttc
ttttatggctgtggctttcggcatttagtgggggattctctgatcaaggttgatgtggtg
aataagacactgaaggtttggagagaagatggcttttatccctcagaacctgtttttgtt
ccagcaccaggaaccaatgaagaagatggtggggttattctttctgtggtgatcactccc
aaccagaatgaaagcaattttatcctagttttggatgccaagaactttgaagagctgggc
cgagcagaggtacctgtgcagatgccttatgggttccatggtaccttcatacccatctga

DBGET integrated database retrieval system