KEGG   Homo sapiens (human): 83879
Entry
83879             CDS       T01001                                 
Symbol
CDCA7, ICF3, JPO1
Name
(RefSeq) cell division cycle associated 7
  KO
K23408  cell division cycle-associated protein 7
Organism
hsa  Homo sapiens (human)
Disease
H02308  Immunodeficiency-centromeric instability-facial anomalies syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    83879 (CDCA7)
   03036 Chromosome and associated proteins [BR:hsa03036]
    83879 (CDCA7)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   Others
    83879 (CDCA7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    83879 (CDCA7)
SSDB
Motif
Pfam: zf-4CXXC_R1 Treacle
Other DBs
NCBI-GeneID: 83879
NCBI-ProteinID: NP_665809
OMIM: 609937
HGNC: 14628
Ensembl: ENSG00000144354
Pharos: Q9BWT1(Tbio)
UniProt: Q9BWT1
Position
2:173354872..173368997
AA seq 371 aa
MDARRVPQKDLRVKKNLKKFRYVKLISMETSSSSDDSCDSFASDNFANTRLQSVREGCRT
RSQCRHSGPLRVAMKFPARSTRGATNKKAESRQPSENSVTDSNSDSEDESGMNFLEKRAL
NIKQNKAMLAKLMSELESFPGSFRGRHPLPGSDSQSRRPRRRTFPGVASRRNPERRARPL
TRSRSRILGSLDALPMEEEEEEDKYMLVRKRKTVDGYMNEDDLPRSRRSRSSVTLPHIIR
PVEEITEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDTKTNCRNPDCWGVRGQFCGPC
LRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKYHGFGNVHAYL
KSLKQEFEMQA
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggacgctcgccgcgtgccgcagaaagatctcagagtaaagaagaacttaaagaaattc
agatatgtgaagttgatttccatggaaacctcgtcatcctctgatgacagttgtgacagc
tttgcttctgataattttgcaaacacgaggctgcagtcagttcgggaaggctgtaggacc
cgcagccagtgcaggcactctggacctctcagggtggcgatgaagtttccagcgcggagt
accaggggagcaaccaacaaaaaagcagagtcccgccagccctcagagaattctgtgact
gattccaactccgattcagaagatgaaagtggaatgaattttttggagaaaagggcttta
aatataaagcaaaacaaagcaatgcttgcaaaactcatgtctgaattagaaagcttccct
ggctcgttccgtggaagacatcccctcccaggctccgactcacaatcaaggagaccgcga
aggcgtacattcccgggtgttgcttccaggagaaaccctgaacggagagctcgtcctctt
accaggtcaaggtcccggatcctcgggtcccttgacgctctacccatggaggaggaggag
gaagaggataagtacatgttggtgagaaagaggaagaccgtggatggctacatgaatgaa
gatgacctgcccagaagccgtcgctccagatcatccgtgacccttccgcatataattcgc
ccagtggaagaaattacagaggaggagttggagaacgtctgcagcaattctcgagagaag
atatataaccgttcactgggctctacttgtcatcaatgccgtcagaagactattgatacc
aaaacaaactgcagaaacccagactgctggggcgttcgaggccagttctgtggcccctgc
cttcgaaaccgttatggtgaagaggtcagggatgctctgctggatccgaactggcattgc
ccgccttgtcgaggaatctgcaactgcagtttctgccggcagcgagatggacggtgtgcg
actggggtccttgtgtatttagccaaatatcatggctttgggaatgtgcatgcctacttg
aaaagcctgaaacaggaatttgaaatgcaagcataa

DBGET integrated database retrieval system