KEGG   Homo sapiens (human): 8388Help
Entry
8388              CDS       T01001                                 

Gene name
OR1E2, OR17-135, OR17-136, OR17-93, OR1E4, OR1E7, OST529
Definition
(RefSeq) olfactory receptor family 1 subfamily E member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    8388 (OR1E2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8388 (OR1E2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    8388 (OR1E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 8388
NCBI-ProteinID: NP_003545
HGNC: 8190
Ensembl: ENSG00000127780
Vega: OTTHUMG00000090651
Pharos: P47887(Tdark)
UniProt: P47887 A0A126GW81
Position
17p13.2
AA seq 323 aa AA seqDB search
MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVY
LFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAY
DRYVAICFPMHYTAICFLLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCAD
NVIPHFFCDMSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSS
KGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLTPFIYS
LRNRDMKGALERVICKRKNPFLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatgggacaaaatcaaaccagcatctcagacttcctgctcctgggcctgcccatccaa
ccagagcagcaaaacctgtgctatgccctgttcttggccatgtatcttaccaccctcctg
gggaacctcctcatcattgtcctcattcgactggactcccatctccacacgcctgtgtat
ttgtttctcagcaacttgtccttctctgacctctgcttttcctcagtcacaatgcccaaa
ttgctgcagaacatgcagaaccaagacccatccatcccctatgcagactgcctgacccaa
atgtacttcttcttgtatttttcggatctagagagcttcctccttgtggccatggcctat
gaccgctatgtggccatctgcttccccatgcactacaccgccatctgcttcctcctgcac
tacaccgccatcatgagccccatgctctgtctctccgtggtggcgctgtcctgggtgctg
accaccttccatgccatgttacacactttactcatggccaggttgtgtttttgtgcagac
aatgtgatcccccactttttctgtgatatgtctgctctgctgaagctggcctgctctgac
actcgagttaatgaatgggtgatatttatcatgggagggctcattcttgtcatcccattc
ctactcatccttgggtcctatgcaagaattgtctcctccatcctcaaggtcccttcttct
aagggtatctgcaaggccttctctacttgtggctcccacctctctgtggtgtcactgttc
tatgggaccgttattggtctctacttatgcccatcagctaatagttctactctaaaggac
actgtcatggctatgatgtacactgtggtgacccctatgctgacccccttcatctacagc
ctgaggaacagagacatgaagggagccctggaaagggtcatttgtaaaaggaaaaatccc
ttccttctatga

DBGET integrated database retrieval system