KEGG   Homo sapiens (human): 83882
Entry
83882             CDS       T01001                                 
Symbol
TSPAN10, OCSP
Name
(RefSeq) tetraspanin 10
  KO
K17351  tetraspanin-10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    83882 (TSPAN10)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 83882
NCBI-ProteinID: NP_001277141
HGNC: 29942
Ensembl: ENSG00000182612
UniProt: Q9H1Z9 Q6PJ65 F1T0E7 F1T0E8
Position
17:81637196..81648755
AA seq 355 aa
MEEGERSPLLSQETAGQKPLSVHRPPTSGCLGPVPREDQAEAWGCSCCPPETKHQALSGT
PKKGPAPSLSPGSSCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADP
MLGLALGGLVVSAVSLAGYLGALCENTCLLRGFSGGILAFLVLEAVAGALVVALWGPLQD
SLEHTLRVAIAHYQDDPDLRFLLDQVQLGLRCCGAASYQDWQQNLYFNCSSPGVQACSLP
ASCCIDPREDGASVNDQCGFGVLRLDADAAQRVVYLEGCGPPLRRWLRANLAASGGYAIA
VVLLQGAELLLAARLLGALAARRGAAYGPGARGEDRAGPQSPSPGAPPAAKPARG
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggaggagggggagaggagccccttactgtcccaggaaactgcaggccagaagcccctc
tctgtgcacaggccacccacctcaggctgcctaggtccagtgcccagggaggaccaggcg
gaggcctggggctgcagctgctgtcccccggagaccaagcaccaggccttgagtggcacc
cccaagaaaggaccagccccttccctctccccagggagcagctgcgtcaagtatctgatc
ttcctctccaacttccccttctccctgctggggctgctggccctggccatcgggctctgg
ggcctggctgtcaaggggtctctgggaagtgatctgggggggcccctgcccgcagacccc
atgctggggctggcactgggagggctggtggtcagcgcagtgagcctggctggctacctg
ggcgccctctgtgagaacacctgcctgttacgtggcttctctgggggcatccttgccttc
ctggtgcttgaggccgtggcgggggccctggtggtggccctctggggcccgctgcaagac
agcctggagcacaccctgcgtgtggccatcgcccactaccaggacgacccagacctgcgc
ttcctcctcgaccaagtccagctcgggctgaggtgctgcggagctgcctcctaccaggac
tggcagcagaacctgtactttaactgcagctcccccggggtgcaggcctgcagccttccc
gcctcctgctgcatcgacccccgcgaagatggagcctctgtcaacgaccagtgcggcttc
ggggtcctgcgcctggatgcggacgcagctcagagagtggtgtacctggagggctgcggc
ccgccgctccggcggtggctgcgcgcgaacctggctgcctcgggcggctacgcaatcgcg
gtggtgctgctgcagggcgcggagctcctgctggccgcccggctactcggggccctcgct
gcccgcaggggggcggcgtacggccccggagcgcgcggggaggaccgcgctggcccccag
agccccagccccggcgccccgcccgctgccaagcccgcccggggctga

DBGET integrated database retrieval system