KEGG   Homo sapiens (human): 83884
Entry
83884             CDS       T01001                                 

Gene name
SLC25A2, ORC2, ORNT2
Definition
(RefSeq) solute carrier family 25 member 2
  KO
K15101  solute carrier family 25 (mitochondrial ornithine transporter) member 2/15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    83884 (SLC25A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   83884 (SLC25A2)
SSDB
Motif
Pfam: Mito_carr DUF2277
Other DBs
NCBI-GeneID: 83884
NCBI-ProteinID: NP_114153
OMIM: 608157
HGNC: 22921
Ensembl: ENSG00000120329
Vega: OTTHUMG00000129604
Pharos: Q9BXI2(Tbio)
UniProt: Q9BXI2
Position
5q31.3
AA seq 301 aa
MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGL
RGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFA
ALALCPTELVKCRLQTMYEMEMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQE
VPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVL
SMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEA
Y
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaagtccggtcctggcatccaagccgccatcgacctcacagcgggggccgcagggggg
acagcgtgtgtactgactgggcagcccttcgacacaataaaagtgaagatgcagacgttc
cctgacctgtacaagggcctcaccgactgcttcctgaagacatacgctcaagtgggtctc
cggggcttctacaagggcaccggcccggcacttatggcctacgtcgccgaaaactcggtc
ctcttcatgtgctacgggttctgccagcagtttgtcaggaaagtggctggaatggacaag
caggcaaagctgagtgatctccagactgcagccgcggggtccttcgcctctgcatttgct
gcactggctctctgccccactgagcttgtgaagtgccggctacagaccatgtatgaaatg
gagatgtcagggaagatagcaaaaagccataatacaatttggtctgtcgtgaagggtatc
cttaaaaaggatggccccttgggcttctaccatggactctcgagtactctacttcaagaa
gtaccgggttatttctttttctttggtggctatgaactgagccgatcgttttttgcgtca
gggagatcaaaagatgaactaggccctgtccatttgatgttaagtggtggagttgctgga
atttgcctgtggcttgtcgtgttcccagtggattgtattaaatccagaattcaagttctt
tccatgtatgggaaacaggcaggatttattggtaccctcttaagtgttgtgagaaatgaa
ggaatagtagccttatattctggactgaaagctactatgattcgagcaatccctgccaat
ggggcactgtttgtggcctacgaatacagcaggaagatgatgatgaaacagttggaagca
tactga

DBGET integrated database retrieval system