KEGG   Homo sapiens (human): 83886Help
Entry
83886             CDS       T01001                                 

Gene name
PRSS27, CAPH2, MPN
Definition
(RefSeq) serine protease 27
  KO
K09628  serine protease 27 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    83886 (PRSS27)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     83886 (PRSS27)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   83886 (PRSS27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 83886
NCBI-ProteinID: NP_114154
OMIM: 608018
HGNC: 15475
Ensembl: ENSG00000172382
Vega: OTTHUMG00000128929
Pharos: Q9BQR3(Tbio)
UniProt: Q9BQR3
Position
16p13.3
AA seq 290 aa AA seqDB search
MRRPAAVPLLLLLCFGSQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFC
GGSLIAEQWVLTAAHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTA
SSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQK
LAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQS
WLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRIIPKLQFQPARLGGQK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggccggcggcggtgccgctcctgctgctgctgtgttttgggtctcagagggcc
aaggcagcaacagcctgtggtcgccccaggatgctgaaccgaatggtgggcgggcaggac
acgcaggagggcgagtggccctggcaagtcagcatccagcgcaacggaagccacttctgc
gggggcagcctcatcgcggagcagtgggtcctgacggctgcgcactgcttccgcaacacc
tctgagacgtccctgtaccaggtcctgctgggggcaaggcagctagtgcagccgggacca
cacgctatgtatgcccgggtgaggcaggtggagagcaaccccctgtaccagggcacggcc
tccagcgctgacgtggccctggtggagctggaggcaccagtgcccttcaccaattacatc
ctccccgtgtgcctgcctgacccctcggtgatctttgagacgggcatgaactgctgggtc
actggctggggcagccccagtgaggaagacctcctgcccgaaccgcggatcctgcagaaa
ctcgctgtgcccatcatcgacacacccaagtgcaacctgctctacagcaaagacaccgag
tttggctaccaacccaaaaccatcaagaatgacatgctgtgcgccggcttcgaggagggc
aagaaggatgcctgcaagggcgactcgggcggccccctggtgtgcctcgtgggtcagtcg
tggctgcaggcgggggtgatcagctggggtgagggctgtgcccgccagaaccgcccaggt
gtctacatccgtgtcaccgcccaccacaactggatccatcggatcatccccaaactgcag
ttccagccagcgaggttgggcggccagaagtga

DBGET integrated database retrieval system