KEGG   Homo sapiens (human): 83888
Entry
83888             CDS       T01001                                 

Gene name
FGFBP2, HBP17RP, KSP37
Definition
(RefSeq) fibroblast growth factor binding protein 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FGF-BP1
Other DBs
NCBI-GeneID: 83888
NCBI-ProteinID: NP_114156
OMIM: 607713
HGNC: 29451
Ensembl: ENSG00000137441
Vega: OTTHUMG00000128513
Pharos: Q9BYJ0(Tdark)
UniProt: Q9BYJ0
Position
4p15.32
AA seq 223 aa
MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLR
VDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREA
GPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
PTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG
NT seq 672 nt   +upstreamnt  +downstreamnt
atgaagttcgtcccctgcctcctgctggtgaccttgtcctgcctggggactttgggtcag
gccccgaggcaaaagcaaggaagcactggggaggaattccatttccagactggagggaga
gattcctgcactatgcgtcccagcagcttggggcaaggtgctggagaagtctggcttcgt
gtcgactgccgcaacacagaccagacctactggtgtgagtacagggggcagcccagcatg
tgccaggctttcgctgctgaccccaaaccttactggaatcaagccctgcaggagctgagg
cgccttcaccatgcgtgccagggggccccggtgcttaggccatccgtgtgcagggaggct
ggaccccaggcccatatgcagcaggtgacttccagcctcaagggcagcccagagcccaac
cagcagcctgaggctgggacgccatctctgaggcccaaggccacagtgaaactcacagaa
gcaacacagctgggaaaggactcgatggaagagctgggaaaagccaaacccaccacccga
cccacagccaaacctacccagcctggacccaggcccggagggaatgaggaagcaaagaag
aaggcctgggaacattgttggaaacccttccaggccctgtgcgcctttctcatcagcttc
ttccgagggtga

DBGET integrated database retrieval system