KEGG   Homo sapiens (human): 839Help
Entry
839               CDS       T01001                                 

Gene name
CASP6, MCH2
Definition
(RefSeq) caspase 6
  KO
K04396  caspase 6 [EC:3.4.22.59]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    839 (CASP6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    839 (CASP6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.59  caspase-6
     839 (CASP6)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   839 (CASP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 839
NCBI-ProteinID: NP_001217
OMIM: 601532
HGNC: 1507
Ensembl: ENSG00000138794
Vega: OTTHUMG00000131914
Pharos: P55212(Tchem)
UniProt: P55212
Structure
PDB: 

Position
4q25
AA seq 293 aa AA seqDB search
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLT
LPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLS
HGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDN
QTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG
SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagctcggcctcggggctccgcagggggcacccggcaggtggggaagaaaacatgaca
gaaacagatgccttctataaaagagaaatgtttgatccggcagaaaagtacaaaatggac
cacaggaggagaggaattgctttaatcttcaatcatgagaggttcttttggcacttaaca
ctgccagaaaggcggggcacctgcgcagatagagacaatcttacccgcaggttttcagat
ctaggatttgaagtgaaatgctttaatgatcttaaagcagaagaactactgctcaaaatt
catgaggtgtcaactgttagccacgcagatgccgattgctttgtgtgtgtcttcctgagc
catggcgaaggcaatcacatttatgcatatgatgctaaaatcgaaattcagacattaact
ggcttgttcaaaggagacaagtgtcacagcctggttggaaaacccaagatatttatcatt
caggcatgtcggggaaaccagcacgatgtgccagtcattcctttggatgtagtagataat
cagacagagaagttggacaccaacataactgaggtggatgcagcctccgtttacacgctg
cctgctggagctgacttcctcatgtgttactctgttgcagaaggatattattctcaccgg
gaaactgtgaacggctcatggtacattcaagatttgtgtgagatgttgggaaaatatggc
tcctccttagagttcacagaactcctcacactggtgaacaggaaagtttctcagcgccga
gtggacttttgcaaagacccaagtgcaattggaaagaagcaggttccctgttttgcctca
atgctaactaaaaagctgcatttctttccaaaatctaattaa

DBGET integrated database retrieval system