KEGG   Homo sapiens (human): 83900
Entry
83900             CDS       T01001                                 

Gene name
KRTAP9-3, KAP9.3, KRTAP9.3
Definition
(RefSeq) keratin associated protein 9-3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Keratin_B2_2 Keratin_B2
Other DBs
NCBI-GeneID: 83900
NCBI-ProteinID: NP_114168
HGNC: 16927
Ensembl: ENSG00000204873
Vega: OTTHUMG00000133427
Pharos: Q9BYQ3(Tdark)
UniProt: Q9BYQ3
Position
17q21.2
AA seq 159 aa
MTHCCSPCCQPTCCRTTCWQPTTVTTCSSTPCCQPSCCVSSCCQPCCHPTCCQNTCCRTT
CCQPICVTSCCQPSCCSTPCCQPTCCGSSCGQSSSCAPVYCRRTCYHPTSVCLPGCLNQS
CGSNCCQPCCRPACCETTCCRTTCFQPTCVYSCCQPSCC
NT seq 480 nt   +upstreamnt  +downstreamnt
atgacccactgttgctccccttgctgtcagcctacctgctgcaggaccacctgctggcag
cccaccactgtgaccacctgcagcagcacaccctgctgtcagccctcctgctgtgtttcc
agctgctgccagccttgctgccacccaacttgctgtcaaaacacctgctgtaggaccacc
tgctgccagcccatctgtgtgaccagctgctgccagccttcctgctgtagcacaccctgc
tgccagcccacatgctgtgggtccagctgtggtcagagcagctcctgtgcacctgtgtac
tgcagaagaacctgctaccaccccacaagtgtttgtctgcctggttgcctaaaccagagc
tgtggctccaactgctgccagccctgctgccgcccagcctgctgtgagaccacctgctgc
aggaccacttgtttccagcccacctgtgtgtacagctgctgccagccttcttgctgctaa

DBGET integrated database retrieval system