KEGG   Homo sapiens (human): 83903Help
Entry
83903             CDS       T01001                                 

Gene name
HASPIN, GSG2
Definition
(RefSeq) histone H3 associated protein kinase
  KO
K16315  serine/threonine-protein kinase haspin [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    83903 (HASPIN)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    83903 (HASPIN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83903 (HASPIN)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Haspin family
   83903 (HASPIN)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    83903 (HASPIN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Haspin_kinase Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 83903
NCBI-ProteinID: NP_114171
OMIM: 609240
HGNC: 19682
Ensembl: ENSG00000177602
Vega: OTTHUMG00000090703
Pharos: Q8TF76(Tbio)
UniProt: Q8TF76 A0PJ70
Structure
PDB: 

Position
17p13.2
AA seq 798 aa AA seqDB search
MAASLPGPGSRLFRTYGAADGRRQRRPGREAAQWFPPQDRRRFFNSSGSSDASIGDPSQS
DDPDDPDDPDFPGSPVRRRRRRPGGRVPKDRPSLTVTPKRWKLRARPSLTVTPRRLGLRA
RPPQKCSTPCGPLRLPPFPSRDSGRLSPDLSVCGQPRDGDELGISASLFSSLASPCPGSP
TPRDSVISIGTSACLVAASAVPSGLHLPEVSLDRASLPCSQEEATGGAKDTRMVHQTRAS
LRSVLFGLMNSGTPEDSEFRADGKNMRESCCKRKLVVGNGPEGPGLSSTGKRRATGQDSC
QERGLQEAVRREHQEASVPKGRIVPRGIDRLERTRSSRKSKHQEATETSLLHSHRFKKGQ
KLGKDSFPTQDLTPLQNVCFWTKTRASFSFHKKKIVTDVSEVCSIYTTATSLSGSLLSEC
SNRPVMNRTSGAPSSWHSSSMYLLSPLNTLSISNKKASDAEKVYGECSQKGPVPFSHCLP
TEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISK
ELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLF
IVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKT
SLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFD
IYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRT
MLNFSSATDLLCQHSLFK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcgctcccgggacctgggagccggcttttccgcacatatggggctgcggac
ggcaggagacagcggcggccgggccgggaagccgcgcagtggttcccgccgcaggaccgg
aggcgtttcttcaacagcagcggcagcagcgacgccagcatcggcgacccctcgcagtcc
gacgatcctgacgatcccgacgaccccgacttccccggcagcccggtgaggcggcggcgg
aggcgtcccggcggccgagtgcccaaggaccggcccagcctgaccgtgaccccaaagcgc
tggaagctgcgagctcgcccaagcctaaccgtgaccccaagacgcctggggctgcgagct
cggcccccgcagaagtgcagcacaccctgcggcccgctccgacttccgcccttccccagc
cgcgactccggccgcctcagcccggacctcagcgtgtgcggccagcccagggacggcgac
gagctgggcatcagtgcctccctgttcagctctctggcctcgccctgccccgggtcccca
acgccaagggacagtgtcatctcgatcggcacctccgcctgtctggttgcagcctcagcc
gtcccgagcggcctccacctcccagaagtctccctggaccgagcatctctcccctgctcc
caggaggaagcgacaggaggagccaaggacaccaggatggtccaccaaacccgcgccagc
ctcaggtcagttctctttggccttatgaactcaggaacccctgaggattctgagtttcgg
gcagatgggaagaatatgagagagtcctgctgtaaaaggaaactggtggtgggaaatgga
ccagagggtccaggtctgtcaagcacaggcaagaggagggccacaggccaggactcttgt
caagagagagggcttcaagaggccgtccggagagagcatcaggaggccagtgttcccaag
ggccgcattgtgccaaggggaatagacaggctggagagaactagatcaagccggaagagc
aaacatcaggaggcaacggaaacctctctcctccattcccaccgctttaaaaagggccaa
aagctgggaaaagattcgttccccacccaggacctgactcctttacagaatgtctgcttt
tggaccaaaaccagggcttccttcagtttccacaagaagaaaattgtgactgatgtgtca
gaggtctgcagcatctataccactgccacttctctctctggatccctcctatcagaatgt
tcaaaccggcctgtcatgaacagaacaagtggtgctccgtcctcttggcactcctcctct
atgtatttgctaagccccttaaacactctaagtatttcaaacaaaaaggcatctgatgct
gaaaaggtttatggggaatgcagtcagaagggtcctgtcccctttagccattgccttccc
acagaaaaactgcaacgctgtgagaagattggggaaggggtgtttggcgaagtgtttcaa
acaattgctgatcacacacccgtagccataaaaatcattgctattgaaggaccagattta
gtcaatggatcccatcagaaaacctttgaggaaatcctgccagagatcatcatctccaaa
gagttgagcctcttatccggtgaagtgtgcaaccgcacagaaggctttatcgggctgaac
tcagtgcactgtgtccagggatcttaccctcccttgctcctcaaagcctgggatcactat
aattcaaccaaaggctctgcaaatgaccggcctgatttttttaaagacgaccagctcttc
attgtgctggaatttgagtttggagggattgacttagagcaaatgcgaaccaagttgtct
tccttggctactgcaaagagcattctacaccagctcacagcctccctcgcagtggcagag
gcatcactgcgctttgagcaccgagacttacactgggggaacgtgctcttaaagaaaacc
agcctcaaaaaactccactacaccctcaatgggaagagcagcactatccccagctgtggg
ttgcaagtgagcatcattgactacaccctgtcgcgcttggaacgggatgggattgtggtt
ttctgtgacgtttccatggatgaggacctgtttaccggtgacggtgactaccagtttgac
atctacaggctcatgaagaaggagaataacaaccgctggggtgaatatcacccttatagt
aatgtgctctggttacattacctgacagacaagatgctgaaacaaatgaccttcaagact
aaatgtaacactcctgccatgaagcaaattaagagaaaaatccaggagttccacaggaca
atgctgaacttcagctctgccactgacttgctctgccagcacagtctgtttaagtaa

DBGET integrated database retrieval system