KEGG   Homo sapiens (human): 83931Help
Entry
83931             CDS       T01001                                 

Gene name
STK40, SHIK, SgK495
Definition
(RefSeq) serine/threonine kinase 40
  KO
K16312  serine/threonine-protein kinase 40 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83931 (STK40)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  Other
   83931 (STK40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 83931
NCBI-ProteinID: NP_001269476
OMIM: 609437
HGNC: 21373
Ensembl: ENSG00000196182
Vega: OTTHUMG00000008238
Pharos: Q8N2I9(Tdark)
UniProt: Q8N2I9
Structure
PDB: 

Position
1p34.3
AA seq 435 aa AA seqDB search
MKRRASDRGAGETSARAKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQCLARKDGTD
DFYQLKILTLEERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEI
VEDTESSRMVKKMKKRICLVLDCLCAHDFSDKTADLINLQHYVIKEKRLSERETVVIFYD
VVRVVEALHQKNIVHRDLKLGNMVLNKRTHRITITNFCLGKHLVSEGDLLKDQRGSPAYI
SPDVLSGRPYRGKPSDMWALGVVLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPEDGRVS
ENTVCLIRKLLVLDPQQRLAAADVLEALSAIIASWQSLSSLSGPLQVVPDIDDQMSNADS
SQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPM
TSLDTAILAQRYLRK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggagagcatcagacagaggagctggggaaacgtcggccagggccaaggctcta
ggaagtgggatttctggaaataatgcaaagagagctggaccattcatccttggtccccgt
ctgggcaactcaccggtgccaagcatagtgcagtgtttggcgaggaaagatggcacggat
gacttctatcagctgaagatcctgaccctggaggagaggggggaccaaggcatagagagc
caggaagagcggcagggcaagatgctgctgcacaccgagtactcactgctgtctctcctg
cacacgcaggatggcgtggtgcaccaccacggcctcttccaggaccgcacctgtgaaatc
gttgaggacacagaatccagccggatggttaagaagatgaagaagcgcatctgcctcgtc
ctggactgcctctgtgctcatgacttcagcgataagaccgctgacctcatcaacctgcag
cactacgtcatcaaggagaagaggctcagcgagagggagactgtggtaatcttctacgac
gtggtccgcgtggtggaggccctgcaccagaaaaatatcgtgcacagagacctgaagctg
gggaacatggtgctcaacaagaggacacatcggataaccatcaccaacttctgcctcggg
aagcatctggtgagcgagggggacctgctgaaggaccagagagggagccctgcctacatc
agtcccgacgtgctcagcggccggccgtaccgtggcaagcccagtgacatgtgggccctg
ggcgtggtgctcttcaccatgctgtatggccagttccccttctacgacagcatcccgcag
gagctcttccgcaagatcaaggctgccgagtataccattcctgaggatggacgggtttct
gagaacaccgtgtgtctcatccggaagctgctggtccttgacccccagcagcgcctggcc
gccgccgacgtcctggaggccctcagtgccatcattgcatcatggcagtccctgtcatct
ctgagtgggcctttgcaagtggttcctgacattgatgaccaaatgagcaatgcggatagc
tcccaggaggcgaaggtgacggaggagtgctcccagtacgagtttgagaactacatgcgt
cagcagctgctgctggccgaggagaagagctccatccatgacgcccggagctgggtaccc
aagcggcagttcggcagcgcaccaccggtgcgacggctgggccacgacgcacagcccatg
acctccttggacacggccatcctggcgcagcgctacctgcggaaataa

DBGET integrated database retrieval system