KEGG   Homo sapiens (human): 83933Help
Entry
83933             CDS       T01001                                 

Gene name
HDAC10, HD10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    83933 (HDAC10)
  09165 Substance dependence
   05034 Alcoholism
    83933 (HDAC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    83933 (HDAC10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     83933 (HDAC10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     83933 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 83933
NCBI-ProteinID: NP_114408
OMIM: 608544
HGNC: 18128
Ensembl: ENSG00000100429
Vega: OTTHUMG00000044647
Pharos: Q969S8(Tclin)
UniProt: Q969S8
Position
22q13.33
AA seq 669 aa AA seqDB search
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEEL
GLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTG
AVQNGLALVRPPGHHGQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQ
YLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
AFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQAPHWKSLQQQ
DVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIA
ATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALS
MFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL
AGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKM
LQCHPHLVA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgcgcttgtgtaccatgaggacatgacggccacccggctgctctgggacgac
cccgagtgcgagatcgagcgtcctgagcgcctgaccgcagccctggatcgcctgcggcag
cgcggcctggaacagaggtgtctgcggttgtcagcccgcgaggcctcggaagaggagctg
ggcctggtgcacagcccagagtatgtatccctggtcagggagacccaggtcctaggcaag
gaggagctgcaggcgctgtccggacagttcgacgccatctacttccacccgagtaccttt
cactgcgcgcggctggccgcaggggctggactgcagctggtggacgctgtgctcactgga
gctgtgcaaaatgggcttgccctggtgaggcctcccgggcaccatggccagagggcggct
gccaacgggttctgtgtgttcaacaacgtggccatagcagctgcacatgccaagcagaaa
cacgggctacacaggatcctcgtcgtggactgggatgtgcaccatggccaggggatccag
tatctctttgaggatgaccccagcgtcctttacttctcctggcaccgctatgagcatggg
cgcttctggcctttcctgcgagagtcagatgcagacgcagtggggcggggacagggcctc
ggcttcactgtcaacctgccctggaaccaggttgggatgggaaacgctgactacgtggct
gccttcctgcacctgctgctcccactggcctttgagtttgaccctgagctggtgctggtc
tcggcaggatttgactcagccatcggggaccctgaggggcaaatgcaggccacgccagag
tgcttcgcccacctcacacagctgctgcaggtgctggccggcggccgggtctgtgccgtg
ctggagggcggctaccacctggagtcactggcggagtcagtgtgcatgacagtacagacg
ctgctgggtgacccggccccacccctgtcagggccaatggcgccatgtcagagtgcccta
gagtccatccagagtgcccgtgctgcccaggccccgcactggaagagcctccagcagcaa
gatgtgaccgctgtgccgatgagccccagcagccactccccagaggggaggcctccacct
ctgctgcctgggggtccagtgtgtaaggcagctgcatctgcaccgagctccctcctggac
cagccgtgcctctgccccgcaccctctgtccgcaccgctgttgccctgacaacgccggat
atcacattggttctgccccctgacgtcatccaacaggaagcgtcagccctgagggaggag
acagaagcctgggccaggccacacgagtccctggcccgggaggaggccctcactgcactt
gggaagctcctgtacctcttagatgggatgctggatgggcaggtgaacagtggtatagca
gccactccagcctctgctgcagcagccaccctggatgtggctgttcggagaggcctgtcc
cacggagcccagaggctgctgtgcgtggccctgggacagctggaccggcctccagacctc
gcccatgacgggaggagtctgtggctgaacatcaggggcaaggaggcggctgccctatcc
atgttccatgtctccacgccactgccagtgatgaccggtggtttcctgagctgcatcttg
ggcttggtgctgcccctggcctatggcttccagcctgacctggtgctggtggcgctgggg
cctggccatggcctgcagggcccccacgctgcactcctggctgcaatgcttcgggggctg
gcagggggccgagtcctggccctcctggaggagaactccacaccccagctagcagggatc
ctggcccgggtgctgaatggagaggcacctcctagcctaggcccttcctctgtggcctcc
ccagaggacgtccaggccctgatgtacctgagagggcagctggagcctcagtggaagatg
ttgcagtgccatcctcacctggtggcttga

DBGET integrated database retrieval system