KEGG   Homo sapiens (human): 83938Help
Entry
83938             CDS       T01001                                 

Gene name
LRMDA, C10orf11, CDA017
Definition
(RefSeq) leucine rich melanocyte differentiation associated
Organism
hsa  Homo sapiens (human)
Disease
H00168  Oculocutaneous albinism (OCA)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_9 LRR_4 LRR_8
Motif
Other DBs
NCBI-GeneID: 83938
NCBI-ProteinID: NP_114413
OMIM: 614537
HGNC: 23405
Ensembl: ENSG00000148655
Vega: OTTHUMG00000018532
Pharos: Q9H2I8(Tdark)
UniProt: Q9H2I8
Position
10q22.2-q22.3
AA seq 198 aa AA seqDB search
MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRIT
DLENLLDHLAEVTPALEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDA
QKVTRQEREEALVRGVFMKVVKPKASSEDVASSPERHYTPLPSASRELTSHQGVLGKCRY
VYYGKNSEGNRFIRDDQL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtatttgtcactcagcggcaatcattcttcaaataaaaggtcactggaagga
ctgagcgcattcaggagcctggaggaactcatcttggacaacaatcagctgggggacgac
cttgtgttgccagggttacccagactgcataccttaaccctcaacaagaaccgaatcact
gatttggagaacctgctggatcacttggcagaagtgacaccagctctggagtacctcagt
ctgctgggcaacgtggcctgtcccaacgagctggtcagcttggaaaaggatgaggaagac
tacaagagatacagatgctttgttctgtacaagctgcccaacttgaaatttctggatgcc
cagaaagtaaccagacaagaacgagaggaggcgttggtcagaggagtcttcatgaaggtg
gtgaagcccaaggcttctagtgaggacgttgccagctccccggagcgccactacacgccc
ttgccttctgcttccagggaactcaccagtcaccaaggtgtcctggggaagtgtcgctac
gtttactatgggaaaaactcagagggcaacaggtttatccgagatgaccagctctga

DBGET integrated database retrieval system