KEGG   Homo sapiens (human): 8394Help
Entry
8394              CDS       T01001                                 

Gene name
PIP5K1A
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase type 1 alpha
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
hsa05231  Choline metabolism in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8394 (PIP5K1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8394 (PIP5K1A)
   04072 Phospholipase D signaling pathway
    8394 (PIP5K1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8394 (PIP5K1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8394 (PIP5K1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8394 (PIP5K1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8394 (PIP5K1A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    8394 (PIP5K1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8394 (PIP5K1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     8394 (PIP5K1A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    8394 (PIP5K1A)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    8394 (PIP5K1A)
 Endosome - Golgi transport
  Others
   Others
    8394 (PIP5K1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 8394
NCBI-ProteinID: NP_001129110
OMIM: 603275
HGNC: 8994
Ensembl: ENSG00000143398
Vega: OTTHUMG00000012351
Pharos: Q99755(Tbio)
UniProt: Q99755
Position
1q21.3
AA seq 562 aa AA seqDB search
MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMP
IKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIF
FPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASG
SLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIR
IVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADM
YNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALY
STAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWK
ALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSC
ITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGET
LQMLTTSTTLEKLEVAESEFTH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggcctcctccgggccgtcgtcttcggtcggtttttcatcctttgatcccgcg
gtcccttcctgtaccttgtcctcagcagcatctggaatcaagagacccatggcatctgag
gtcttggaagctagacaggattcttacatctcattggtgccttatgcctctggcatgccc
atcaagaaaataggccatagaagtgttgattcctcaggagagacaacatataaaaagaca
acctcatcagccttgaaaggtgccatccagttaggcattacccacactgtggggagcctg
agtaccaaaccagagcgtgatgtcctcatgcaagatttctacgtggttgagagtatcttc
tttcccagtgaagggagcaacctgacccctgctcatcactacaatgactttcgtttcaag
acctatgcacctgttgccttccgctacttccgggagctatttggtatccggcccgatgat
tacttgtattccctctgcagtgagccgctgattgaactctgtagctctggagctagtggt
tccctattctatgtgtccagcgacgatgagttcattattaagacagtccaacataaagag
gcggaatttctgcagaagctgcttccaggatactacatgaacctcaaccagaaccctcgg
actttgctgcctaaattctatggactgtactgtgtgcaggcaggtggcaagaacattcgg
attgtggtgatgaacaatcttttaccaagatcggtaaaaatgcatatcaaatatgacctc
aaaggctcaacctacaaacggcgggcttcccagaaagagcgagagaagcctcttcccaca
tttaaagacctagacttcttacaagacatccctgatggtctttttttggatgctgacatg
tacaacgctctctgtaagaccctgcagcgtgactgtttggtgctgcagagcttcaagata
atggattacagcctcttgatgtcaatccataatatagatcatgcacaacgagagccctta
agcagtgaaacacagtactcagttgatactcgaagaccggccccccaaaaggctctgtat
tccacagccatggaatccatccagggagaggctcgacggggtggtaccatggagactgat
gaccatatgggtggcatccctgcccggaatagtaaaggggaaaggcttctgctttatatt
ggcatcattgacattctacagtcttacaggtttgttaagaagttggagcactcttggaaa
gccctggtacatgacggagacactgtctcagtgcatcgcccaggcttctacgctgaacgg
ttccagcgcttcatgtgcaacacagtatttaagaagattcccttgaagccttctccttcc
aaaaagtttcggtctggctcatctttctctcggcgagcaggctccagtggcaactcctgc
attacttaccagccatcggtctctggggaacacaaggcacaagtgacaacaaaggcagaa
gtggagccaggcgttcaccttggtcgtcctgatgttttacctcagactccacctttggag
gaaatcagtgagggctcgcctattcctgaccccagtttctcacctctagttggagagact
ttgcaaatgctaactacaagtacaaccttggaaaagcttgaagttgcagagtcagagttc
acccattaa

DBGET integrated database retrieval system