KEGG   Homo sapiens (human): 8396Help
Entry
8396              CDS       T01001                                 

Gene name
PIP4K2B, PI5P4KB, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PIP5P4KB
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase type 2 beta
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa04070  Phosphatidylinositol signaling system
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8396 (PIP4K2B)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    8396 (PIP4K2B)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8396 (PIP4K2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     8396 (PIP4K2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 8396
NCBI-ProteinID: NP_003550
OMIM: 603261
HGNC: 8998
Ensembl: ENSG00000276293
Vega: OTTHUMG00000188504
Pharos: P78356(Tchem)
UniProt: P78356
Structure
PDB: 

Position
17q12
AA seq 416 aa AA seqDB search
MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNV
PVPVMLMPDDFKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNS
VTRSAPINSDSQGRCGTRFLTTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLL
PQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVAREASDKEKAKDLPTFKD
NDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
RAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKK
EVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaactgcaccagcaccacggcggtggcggtggcgccgctcagcgccagcaag
accaagaccaagaagaagcatttcgtgtgccagaaagtgaagctattccgggccagcgag
ccgatcctcagcgtcctgatgtggggggtgaaccacacgatcaatgagctgagcaatgtt
cctgttcctgtcatgctaatgccagatgacttcaaagcctacagcaagatcaaggtggac
aatcatctcttcaataaggagaacctgcccagccgctttaagtttaaggagtattgcccc
atggtgttccgaaaccttcgggagaggtttggaattgatgatcaggattaccagaattca
gtgacgcgcagcgcccccatcaacagtgacagccagggtcggtgtggcacgcgtttcctc
accacctacgaccggcgctttgtcatcaagactgtgtccagcgaggacgtggcggagatg
cacaacatcttaaagaaataccaccagtttatagtggagtgtcatggcaacacgcttttg
ccacagttcctgggcatgtaccgcctgaccgtggatggtgtggaaacctacatggtggtt
accaggaacgtgttcagccatcggctcactgtgcatcgcaagtatgacctcaagggttct
acggttgccagagaagcgagcgacaaggagaaggccaaggacttgccaacattcaaagac
aatgacttcctcaatgaagggcagaagctgcatgtgggagaggagagtaaaaagaacttc
ctggagaaactgaagcgggacgttgagttcttggcacagctgaagatcatggactacagc
ctgctggtgggcatccacgacgtggaccgggcagagcaggaggagatggaggtggaggag
cgggcagaggacgaggagtgtgagaatgatggggtgggtggcaacctactctgctcctat
ggcacacctccggacagccctggcaacctcctcagctttcctcggttctttggtcctggg
gaattcgacccctctgttgacgtctatgccatgaaaagccatgaaagttcccccaagaag
gaggtgtatttcatggccatcattgatatcctcacgccatacgatacaaagaagaaagct
gcacatgctgccaaaacggtgaaacacggggcaggggccgagatctcgactgtgaaccct
gagcagtactccaaacgcttcaacgagtttatgtccaacatcctgacgtag

DBGET integrated database retrieval system