KEGG   Homo sapiens (human): 8398Help
Entry
8398              CDS       T01001                                 

Gene name
PLA2G6, CaI-PLA2, GVI, INAD1, IPLA2-VIA, NBIA2, NBIA2A, NBIA2B, PARK14, PLA2, PNPLA9, iPLA2, iPLA2beta
Definition
(RefSeq) phospholipase A2 group VI
  KO
K16343  calcium-independent phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04750  Inflammatory mediator regulation of TRP channels
Disease
H00057  Parkinson disease
H00833  Neurodegeneration with brain iron accumulation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8398 (PLA2G6)
   00565 Ether lipid metabolism
    8398 (PLA2G6)
   00590 Arachidonic acid metabolism
    8398 (PLA2G6)
   00591 Linoleic acid metabolism
    8398 (PLA2G6)
   00592 alpha-Linolenic acid metabolism
    8398 (PLA2G6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8398 (PLA2G6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8398 (PLA2G6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8398 (PLA2G6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8398 (PLA2G6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8398 (PLA2G6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 Patatin
Motif
Other DBs
NCBI-GeneID: 8398
NCBI-ProteinID: NP_003551
OMIM: 603604
HGNC: 9039
Ensembl: ENSG00000184381
Vega: OTTHUMG00000151246
Pharos: O60733(Tchem)
UniProt: O60733
Position
22q13.1
AA seq 806 aa AA seqDB search
MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLV
NPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSW
SVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMD
VTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLL
LCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA
RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSK
DNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHG
VPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHL
LCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGM
YFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFR
NYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNP
TLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWELAKT
VFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTVLVN
ALWETEVYIYEHREEFQKLIQLLLSP
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctttggccgcctggtcaataccttcagtggcgtcaccaacttgttctctaac
ccattccgggtgaaggaggtggctgtggccgactacacctcgagtgaccgagttcgggag
gaagggcagctgattctgttccagaacactcccaaccgcacctgggactgcgtcctggtc
aaccccaggaactcacagagtggattccgactcttccagctggagttggaggctgacgcc
ctagtgaatttccatcagtattcttcccagctgctacccttctatgagagctcccctcag
gtcctgcacactgaggtcctgcagcacctgaccgacctcatccgtaaccaccccagctgg
tcagtggcccacctggctgtggagctagggatccgcgagtgcttccatcacagccgtatc
atcagctgtgccaattgcgcggagaacgaggagggctgcacacccctgcacctggcctgc
cgcaagggtgatggggagatcctggtggagctggtgcagtactgccacactcagatggat
gtcaccgactacaagggagagaccgtcttccattatgctgtccagggtgacaattctcag
gtgctgcagctccttggaaggaacgcagtggctggcctgaaccaggtgaataaccaaggg
ctgaccccgctgcacctggcctgccagctggggaagcaggagatggtccgcgtgctgctg
ctgtgcaatgctcggtgcaacatcatgggccccaacggctaccccatccactcggccatg
aagttctctcagaaggggtgtgcggagatgatcatcagcatggacagcagccagatccac
agcaaagacccccgttacggagccagccccctccactgggccaagaacgcagagatggcc
cgcatgctgctgaaacggggctgcaacgtgaacagcaccagctccgcggggaacacggcc
ctgcacgtggcggtgatgcgcaaccgcttcgactgtgccatagtgctgctgacccacggg
gccaacgcggatgcccgcggagagcacggcaacaccccgctgcacctggccatgtcgaaa
gacaacgtggagatgatcaaggccctcatcgtgttcggagcagaagtggacaccccgaat
gactttggggagactcctacattcctagcctccaaaatcggcagacttgtcaccaggaag
gcgatcttgactctgctgagaaccgtgggggccgaatactgcttcccacccatccacggg
gtccccgcggagcagggctctgcagcgccacatcatcccttctccctggaaagagctcag
cccccaccgatcagcctaaacaacctagaactacaggatctcatgcacatctcacgggcc
cggaagccagcgttcatcctgggctccatgagggacgagaagcggacccacgaccacctg
ctgtgcctggatggaggaggagtgaaaggcctcatcatcatccagctcctcatcgccatc
gagaaggcctcgggtgtggccaccaaggacctgtttgactgggtggcgggcaccagcact
ggaggcatcctggccctggccattctgcacagtaagtccatggcctacatgcgcggcatg
tactttcgcatgaaggatgaggtgttccggggctccaggccctacgagtcggggcccctg
gaggagttcctgaagcgggagtttggggagcacaccaagatgacggacgtcaggaaaccc
aaggtgatgctgacagggacactgtctgaccggcagccggctgaactccacctcttccgg
aactacgatgctccagaaactgtccgggagcctcgtttcaaccagaacgttaacctcagg
cctccagctcagccctcagaccagctggtgtggcgggcggcccgaagcagcggggcagct
cctacttacttccgacccaatgggcgcttcctggacggtgggctgctggccaacaacccc
acgctggatgccatgaccgagatccatgagtacaatcaggacctgatccgcaagggtcag
gccaacaaggtgaagaaactctccatcgttgtctccctggggacagggaggtccccacaa
gtgcctgtgacctgtgtggatgtcttccgtcccagcaacccctgggagctggccaagact
gtttttggggccaaggaactgggcaagatggtggtggactgttgcacggatccagacggg
cgggctgtggaccgggcacgggcctggtgcgagatggtcggcatccagtacttcagattg
aacccccagctggggacggacatcatgctggatgaggtcagtgacacagtgctggtcaac
gccctctgggagaccgaggtctacatctatgagcaccgcgaggagttccagaagctcatc
cagctgctgctctcaccctga

DBGET integrated database retrieval system