KEGG   Homo sapiens (human): 83983Help
Entry
83983             CDS       T01001                                 

Gene name
TSSK6, CT72, FKSG82, SSTK, TSSK4
Definition
(RefSeq) testis specific serine kinase 6
  KO
K08811  testis-specific serine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    83983 (TSSK6)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    83983 (TSSK6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83983 (TSSK6)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  TSSK family
   83983 (TSSK6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    83983 (TSSK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH RIO1 Haspin_kinase Choline_kinase
Motif
Other DBs
NCBI-GeneID: 83983
NCBI-ProteinID: NP_114426
OMIM: 610712
HGNC: 30410
Ensembl: ENSG00000178093
Vega: OTTHUMG00000182146
Pharos: Q9BXA6(Tbio)
UniProt: Q9BXA6 A0A024R7Q5
Position
19p13.11
AA seq 273 aa AA seqDB search
MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRE
LSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIA
GAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASP
EVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERC
KALIAELLQFSPSARPSAGQVARNCWLRAGDSG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggagacaaacttctgagcgaactcggttataagctgggccgcacaattggagag
ggcagctactccaaggtgaaggtggccacatccaagaagtacaagggtaccgtggccatc
aaggtggtggaccggcggcgagcgcccccggacttcgtcaacaagttcctgccgcgagag
ctgtccatcctgcggggcgtgcgacacccgcacatcgtgcacgtcttcgagttcatcgag
gtgtgcaacgggaaactgtacatcgtgatggaagcggccgccaccgacctgctgcaagcc
gtgcagcgcaacgggcgcatccccggagttcaggcgcgcgacctctttgcgcagatcgcc
ggcgccgtgcgctacctgcacgatcatcacctggtgcaccgcgacctcaagtgcgaaaac
gtgctgctgagcccggacgagcgccgcgtcaagctcaccgacttcggcttcggccgccag
gcccatggctacccagacctgagcaccacctactgcggctcagccgcctacgcgtcaccc
gaggtgctcctgggcatcccctacgaccccaagaagtacgatgtgtggagcatgggcgtc
gtgctctacgtcatggtcaccgggtgcatgcccttcgacgactcggacatcgccggcctg
ccccggcgccagaaacgcggcgtgctctatcccgaaggcctcgagctgtccgagcgctgc
aaggccctgatcgccgagctgctgcagttcagcccgtccgccaggccctccgcgggccag
gtagcgcgcaactgctggctgcgcgccggggactccggctag

DBGET integrated database retrieval system