KEGG   Homo sapiens (human): 83989
Entry
83989             CDS       T01001                                 
Symbol
FAM172A, C5orf21, Toupee
Name
(RefSeq) family with sequence similarity 172 member A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Arb2 Hydrolase_4
Other DBs
NCBI-GeneID: 83989
NCBI-ProteinID: NP_114431
HGNC: 25365
Ensembl: ENSG00000113391
Pharos: Q8WUF8(Tdark)
UniProt: Q8WUF8 A0A024RAL9
Position
5:complement(93617725..94111699)
AA seq 416 aa
MSISLSSLILLPIWINMAQIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTL
EGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLK
KVSIPVDATESEPKSFIFMSEDALTNPQKLMVLIHGSGVVRAGQWARRLIINEDLDSGTQ
IPFIKRAVAEGYGVIVLNPNENYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKR
RDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFV
ELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESM
LPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtctatttccttgagctctttaattttgttgccaatttggataaacatggcacaaatc
cagcagggaggtccagatgaaaaagaaaagactaccgcactgaaagatttattatctagg
atagatttggatgaactaatgaaaaaagatgaaccgcctcttgattttcctgataccctg
gaaggatttgaatatgcttttaatgaaaagggacagttaagacacataaaaactggggaa
ccatttgtttttaactaccgggaagatttacacagatggaaccagaaaagatacgaggct
ctaggagagatcatcacgaagtatgtatatgagctcctggaaaaggattgtaatttgaaa
aaagtatctattccagtagatgccactgagagtgaaccaaagagttttatctttatgagt
gaggatgctttgacaaatccacagaaactgatggttttaattcatggtagtggtgttgtc
agggcagggcagtgggctagaagacttattataaatgaagatctggacagtggcacacag
ataccgtttattaaaagagctgtggctgaaggatatggagtaatagtactaaatcccaat
gaaaactatattgaagtagaaaagccgaagatacacgtacagtcatcatctgatagttca
gatgaaccagcagaaaaacgggaaagaaaagataaagtttctaaagaaacaaagaagcga
cgtgatttctatgagaagtatcgtaacccccaaagagaaaaagaaatgatgcaattgtat
atcagagaaaatggttctcctgaagaacatgcaatctatgtttgggatcatttcatagct
caggctgctgctgagaatgtgtttttcgttgctcacagctatggaggacttgcttttgtt
gaactgatgattcaacgagaagccgatgtaaaaaataaggtaactgctgtggcattgaca
gactctgttcacaatgtgtggcatcaagaagctggcaaaacgattcgagaatggatgaga
gagaactgttgtaattgggtctctagctcagaaccattagacacatcagtggagtccatg
ctacctgattgcccccgggtctcagcaggcaccgaccgtcacgagctaacttcctggaag
agctttccgtctattttcaaattctttaccgaagcctcagaggccaagaccagctccctg
aagccggctgtgacgcgccgctcccaccgcatcaagcacgaagagctgtaa

DBGET integrated database retrieval system