KEGG   Homo sapiens (human): 840Help
Entry
840               CDS       T01001                                 

Gene name
CASP7, CASP-7, CMH-1, ICE-LAP3, LICE2, MCH3
Definition
(RefSeq) caspase 7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04668  TNF signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05200  Pathways in cancer
Module
hsa_M00685  Apoptotic machinery
Network
N00098  Intrinsic apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00145  Extrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00450  HIV Tat to intrinsic apoptotic pathway
N00451  HIV Tat to intrinsic apoptotic pathway
N00452  HIV Nef to intrinsic apoptotic pathway
N00453  HIV Vpr to intrinsic apoptotic pathway
N00454  HIV Vpr to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    840 (CASP7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    840 (CASP7)
   04215 Apoptosis - multiple species
    840 (CASP7)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    840 (CASP7)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    840 (CASP7)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    840 (CASP7)
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    840 (CASP7)
   05134 Legionellosis
    840 (CASP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    840 (CASP7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     840 (CASP7)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   840 (CASP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 EZH2_N
Motif
Other DBs
NCBI-GeneID: 840
NCBI-ProteinID: NP_001218
OMIM: 601761
HGNC: 1508
Ensembl: ENSG00000165806
Vega: OTTHUMG00000019076
Pharos: P55210(Tchem)
UniProt: P55210
Structure
PDB: 

Position
10q25.3
AA seq 303 aa AA seqDB search
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgatcagggctgtattgaagagcagggggttgaggattcagcaaatgaagat
tcagtggatgctaagccagaccggtcctcgtttgtaccgtccctcttcagtaagaagaag
aaaaatgtcaccatgcgatccatcaagaccacccgggaccgagtgcctacatatcagtac
aacatgaattttgaaaagctgggcaaatgcatcataataaacaacaagaactttgataaa
gtgacaggtatgggcgttcgaaacggaacagacaaagatgccgaggcgctcttcaagtgc
ttccgaagcctgggttttgacgtgattgtctataatgactgctcttgtgccaagatgcaa
gatctgcttaaaaaagcttctgaagaggaccatacaaatgccgcctgcttcgcctgcatc
ctcttaagccatggagaagaaaatgtaatttatgggaaagatggtgtcacaccaataaag
gatttgacagcccactttaggggggatagatgcaaaacccttttagagaaacccaaactc
ttcttcattcaggcttgccgagggaccgagcttgatgatggcatccaggccgactcgggg
cccatcaatgacacagatgctaatcctcgatacaagatcccagtggaagctgacttcctc
ttcgcctattccacggttccaggctattactcgtggaggagcccaggaagaggctcctgg
tttgtgcaagccctctgctccatcctggaggagcacggaaaagacctggaaatcatgcag
atcctcaccagggtgaatgacagagttgccaggcactttgagtctcagtctgatgaccca
cacttccatgagaagaagcagatcccctgtgtggtctccatgctcaccaaggaactctac
ttcagtcaatag

DBGET integrated database retrieval system