KEGG   Homo sapiens (human): 84000
Entry
84000             CDS       T01001                                 

Gene name
TMPRSS13, MSP, MSPL, MSPS, TMPRSS11
Definition
(RefSeq) transmembrane serine protease 13
  KO
K09643  transmembrane protease serine 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    84000 (TMPRSS13)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   84000 (TMPRSS13)
SSDB
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Trypsin_2 Ldl_recept_a
Other DBs
NCBI-GeneID: 84000
NCBI-ProteinID: NP_001070731
OMIM: 610050
HGNC: 29808
Ensembl: ENSG00000137747
Vega: OTTHUMG00000166992
Pharos: Q9BYE2(Tbio)
UniProt: Q9BYE2
Position
11q23.3
AA seq 567 aa
MERDSHGNASPARTPSAGASPAQASPAGTPPGRASPAQASPAQASPAGTPPGRASPAQAS
PAGTPPGRASPGRASPAQASPAQASPARASPALASLSRSSSGRSSSARSASVTTSPTRVY
LVRATPVGAVPIRSSPARSAPATRATRESPGTSLPKFTWREGQKQLPLIGCVLLLIALVV
SLIILFQFWQGHTGIRYKEQRESCPKHAVRCDGVVDCKLKSDELGCVRFDWDKSLLKIYS
GSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHRDFANSFSILRYNSTIQESLH
RSECPSQRYISLQCSHCGLRAMTGRIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQW
VLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRL
SKPLTLSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKC
NDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNK
PGVYTKVTEVLPWIYSKMESEVRFRKS
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggagagggacagccacgggaatgcatctccagcaagaacaccttcagctggagcatct
ccagcccaggcatctccagctgggacacctccaggccgggcatctccagcccaggcatct
ccagcccaggcatctccagctgggacacctccgggccgggcatctccagcccaggcatct
ccagctggtacacctccaggccgggcatctccaggccgggcatctccagcccaggcatct
ccagcccaggcatctccagcccgggcatctccggctctggcatcactttccaggtcctca
tccggcaggtcatcatccgccaggtcagcctcggtgacaacctccccaaccagagtgtac
cttgttagagcaacaccagtgggggctgtacccatccgatcatctcctgccaggtcagca
ccagcaaccagggccaccagggagagcccaggtacgagcctgcccaagttcacctggcgg
gagggccagaagcagctaccgctcatcgggtgcgtgctcctcctcattgccctggtggtt
tcgctcatcatcctcttccagttctggcagggccacacagggatcaggtacaaggagcag
agggagagctgtcccaagcacgctgttcgctgtgacggggtggtggactgcaagctgaag
agtgacgagctgggctgcgtgaggtttgactgggacaagtctctgcttaaaatctactct
gggtcctcccatcagtggcttcccatctgtagcagcaactggaatgactcctactcagag
aagacctgccagcagctgggtttcgagagtgctcaccggacaaccgaggttgcccacagg
gattttgccaacagcttctcaatcttgagatacaactccaccatccaggaaagcctccac
aggtctgaatgcccttcccagcggtatatctctctccagtgttcccactgcggactgagg
gccatgaccgggcggatcgtgggaggggcgctggcctcggatagcaagtggccttggcaa
gtgagtctgcacttcggcaccacccacatctgtggaggcacgctcattgacgcccagtgg
gtgctcactgccgcccactgcttcttcgtgacccgggagaaggtcctggagggctggaag
gtgtacgcgggcaccagcaacctgcaccagttgcctgaggcagcctccattgccgagatc
atcatcaacagcaattacaccgatgaggaggacgactatgacatcgccctcatgcggctg
tccaagcccctgaccctgtccgctcacatccaccctgcttgcctccccatgcatggacag
acctttagcctcaatgagacctgctggatcacaggctttggcaagaccagggagacagat
gacaagacatcccccttcctccgggaggtgcaggtcaatctcatcgacttcaagaaatgc
aatgactacttggtctatgacagttaccttaccccaaggatgatgtgtgctggggacctt
cgtgggggcagagactcctgccagggagacagcggggggcctcttgtctgtgagcagaac
aaccgctggtacctggcaggtgtcaccagctggggcacaggctgtggccagagaaacaaa
cctggtgtgtacaccaaagtgacagaagttcttccctggatttacagcaagatggagagc
gaggtgcgattcagaaaatcctaa

DBGET integrated database retrieval system