KEGG   Homo sapiens (human): 8402Help
Entry
8402              CDS       T01001                                 

Gene name
SLC25A11, OGC, SLC20A4
Definition
(RefSeq) solute carrier family 25 member 11
  KO
K15104  solute carrier family 25 (mitochondrial oxoglutarate transporter), member 11
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    8402 (SLC25A11)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   8402 (SLC25A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 8402
NCBI-ProteinID: NP_003553
OMIM: 604165
HGNC: 10981
Ensembl: ENSG00000108528
Vega: OTTHUMG00000099395
Pharos: Q02978(Tbio)
UniProt: Q02978 Q6IBH0
Position
17p13.2
AA seq 314 aa AA seqDB search
MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTRE
YKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL
LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTL
WRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV
DIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL
EQMNKAYKRLFLSG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacggcgagtgccggggccggcgggatagacgggaagccccgtacctcccct
aagtccgtcaagttcctgtttgggggcctggccgggatgggagctacagtttttgtccag
cccctggacctggtgaagaaccggatgcagttgagcggggaaggggccaagactcgagag
tacaaaaccagcttccatgccctcaccagtatcctgaaggcagaaggcctgaggggcatt
tacactgggctgtcggctggcctgctgcgtcaggccacctacaccactacccgccttggc
atctataccgtgctgtttgagcgcctgactggggctgatggtactccccctggctttctg
ctgaaggctgtgattggcatgaccgcaggtgccactggtgcctttgtgggaacaccagcc
gaagtggctcttatccgcatgactgccgatggccggcttccagctgaccagcgccgtggc
tacaaaaatgtgtttaacgccctgattcgaatcacccgggaagagggtgtcctcacactg
tggcggggctgcatccctaccatggctcgggccgtcgtcgtcaatgctgcccagctcgcc
tcctactcccaatccaagcagttcttactggactcaggctacttctctgacaacatcttg
tgccacttctgtgccagcatgatcagcggtcttgtcaccactgctgcctccatgcctgtg
gacattgccaagacccgaatccagaacatgcggatgattgatgggaagccggaatacaag
aacgggctggacgtgctgttcaaagttgtccgctacgagggcttcttcagcctgtggaag
ggcttcacgccgtactatgcccgcctgggcccccacaccgtcctcaccttcatcttcttg
gagcagatgaacaaggcctacaagcgtctcttcctcagtggctga

DBGET integrated database retrieval system