KEGG   Homo sapiens (human): 84058
Entry
84058             CDS       T01001                                 

Gene name
WDR54
Definition
(RefSeq) WD repeat domain 54
  KO
K24749  WD repeat-containing protein 54
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    84058 (WDR54)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   84058 (WDR54)
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 84058
NCBI-ProteinID: NP_001307753
HGNC: 25770
Ensembl: ENSG00000005448
Vega: OTTHUMG00000129951
Pharos: Q9H977(Tdark)
UniProt: Q9H977
Position
2p13.1
AA seq 334 aa
MFRWERSIPLRGSAAALCNNLSVLQLPARNLTYFGVVHGPSAQLLSAAPEGVPLAQRQLH
AKEGAGVSPPLITQVHWCVLPFRVLLVLTSHRGIQMYESNGYTMVYWHALDSGDASPVQA
VFARGIAASGHFICVGTWSGRVLVFDIPAKGPNIVLSEELAGHQMPITDIATEPAQGQDC
VADMVTADDSGLLCVWRSGPEFTLLTRIPGFGVPCPSVQLWQGIIAAGYGNGQVHLYEAT
TGNLHVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEHCHGECV
ADTQLCGARFCDSSGNSFAVTGYDLAEIRRFSSV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgttccgctgggagcgctccattcccctgcgaggctcggccgccgccctgtgcaacaac
ctcagtgtgctgcagctgccggctcgcaacctcacgtattttggcgtggttcatggacca
agcgcccagcttctcagcgctgctcctgagggtgtgcccttggcccagcgccagctccac
gctaaggagggtgctggagtgagtcccccacttatcactcaggtccactggtgtgtcctc
cccttccgagtgctgctggtactcacctcacatcgaggaatacagatgtacgagtccaat
ggctacaccatggtctactggcatgcactggactctggagatgcctccccagtacaggct
gtgtttgcccggggaattgctgccagtggccacttcatctgtgtgggaacgtggtcaggc
cgggtgctggtgtttgacatcccagcaaagggtcccaacattgtactgagcgaggagctg
gctgggcaccagatgccaatcacagacattgccaccgagcctgcccagggacaggattgt
gtggctgacatggtgacggcagatgactcaggcttgctgtgtgtctggcggtcagggcca
gaattcacattattgacccgcattccaggatttggagttccgtgcccctctgtgcagctg
tggcaggggatcatagcagcaggctatgggaacggacaagtgcatctatatgaggccact
acaggaaatctacatgtccagatcaatgcccatgcccgggccatctgcgccctggacctg
gcttctgaggtgggcaagctactctctgcaggtgaggacacctttgtgcatatctggaag
ctgagcagaaacccagagagtggctacattgaggtggaacactgtcatggtgagtgtgtc
gccgacacccagctgtgtggtgctcgattttgtgattcctcaggcaactcctttgctgtg
actggctatgaccttgcggagatccggagattcagcagtgtgtga

DBGET integrated database retrieval system