KEGG   Homo sapiens (human): 84070
Entry
84070             CDS       T01001                                 
Symbol
FAM186B, C12orf25
Name
(RefSeq) family with sequence similarity 186 member B
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 84070
NCBI-ProteinID: NP_115506
HGNC: 25296
Ensembl: ENSG00000135436
Pharos: Q8IYM0(Tdark)
UniProt: Q8IYM0 A0A024R129
Position
12:complement(49582873..49622758)
AA seq 893 aa
MEKDDPPQLVTPTSVKAIILRIEAAQLTRAQEDISTQLSDILDNVNCVINRFQEELGYDL
KENAKSQQRDPKGKKRFILLEKIASFSKDAMMKEKHLYDILRWLGDWGDTLTYEIGPRKS
EEEAAALDEWIEVTEKVLPLSLIATKRGIESLTALCSTLIEGQKKRSQVSKRTFWQGWQG
RSPQTSPSHPQPLSPEQMLQDQHTMNTKASEVTSMLQELLDSTMFSKGEVRAIRYMATVV
ENLNKALILQHKENRSLETKYRHLQMQATKELSSQRLHFQQFMEVLESRRDALLKQVEIL
GGRYHDLLLMKQALEFQLKKAQNATGQAEDLAEVSVDSPGPSERETLPRKETVMEESQQE
PMKEEQLFSPLPPSPMAMIRDSGAIAAGHQPLSTMTVRSRVADVFGSKDTESLEPVLLPL
VDRRFPKKWERPVAESLGHKDKDQEDYFQKGGLQIKFHCSKQLSLESSRQVTSESQEEPW
EEEFGREMRRQLWLEEEEMWQQRQKKWALLEQEHQEKLRQWNLEDLAREQQRRWVQLEKE
QESPRREPEQLGEDVERRIFTPTSRWRDLEKAELSLVPAPSRTQSAHQSRRPHLPMSPST
QQPALGKQRPMSSVEFTYRPRTRRVPTKPKKSASFPVTGTSIRRLTWPSLQISPANIKKK
VYHMDMEAQRKNLQLLSEESELRLPHYLRSKALELTTTTMELGALRLQYLCHKYIFYRRL
QSLRQEAINHVQIMKETEASYKAQNLYIFLENIDRLQSLRLQAWTDKQKGLEEKHRECLS
SMVTMFPKLQLEWNVHLNIPEVTSPKPKKCKLPAASPRHIRPSGPTYKQPFLSRHRACVP
LQMARQQGKQMEAVWKTEVASSSYAIEKKTPASLPRDQLRGHPDIPRLLTLDV
NT seq 2682 nt   +upstreamnt  +downstreamnt
atggagaaggatgaccccccacagttggtgactcccacatcagtgaaagccatcatcctg
aggattgaggctgcccagctaactcgggctcaagaggatatttctacccagctctcagac
attttggacaatgtcaattgtgtcatcaaccgcttccaggaagaattaggatatgattta
aaagaaaatgccaaatctcagcagagagatccaaagggcaagaagagattcatcttgctg
gaaaaaattgcctccttctccaaagatgctatgatgaaggagaagcacctgtatgacatt
ctccgctggctgggtgactggggtgacactctgacctatgagattgggcccaggaagagt
gaagaggaagcagcagctctggacgaatggattgaagtgacggagaaagtgttaccgctg
tccctcattgccaccaaaagaggcatcgagtcactcactgccctttgctccactctcatt
gaaggacaaaagaaaaggtcacaagtgtccaaacgcaccttctggcagggctggcaggga
agaagcccacagacatctccatcccatcctcagccactaagcccagaacagatgctccag
gaccagcataccatgaacacgaaggcctcggaggtgacgtccatgctgcaggagctcctg
gactctaccatgttcagcaagggggaggtcagggccatcaggtacatggccactgtggtg
gagaacctcaacaaggccttgatcctccaacacaaggagaacaggagcctggagaccaaa
tacaggcacctgcaaatgcaggcgaccaaagagctcagcagccagaggctgcacttccag
cagttcatggaggtccttgagagcaggagggatgctctgctgaagcaggtagagatctta
gggggaaggtaccatgaccttctcctgatgaagcaggccttggagttccagctgaagaag
gctcagaatgctacaggtcaggcagaagacctggctgaggtttctgttgactccccaggt
ccctctgagagagagaccctcccaaggaaagaaacagtcatggaggaaagccaacaggaa
ccgatgaaggaggagcagttgttctcgccacttcccccaagtcccatggccatgatacgg
gacagtggtgctatagctgcagggcaccagccactttccaccatgactgtgcgctcgagg
gtcgcagatgtgttcggcagcaaggacactgagagccttgagcctgtgcttttaccctta
gtagatcgcaggtttcctaagaaatgggaaagaccggtggcagaaagcttaggccacaaa
gacaaagaccaggaggactacttccagaagggaggactccaaattaagttccactgtagc
aagcagctgtctctagagagctccaggcaggtgacctctgagagccaagaggagccctgg
gaggaggaattcggccgggagatgcggaggcagctgtggctggaggaggaggagatgtgg
cagcagcggcagaagaagtgggccctgctggagcaggagcatcaggagaagctgcggcag
tggaatctggaagacctggccagggagcaacagcggagatgggtccagctagaaaaggag
caggagagcccacggagagagccagagcagctaggggaggatgtggagaggaggatcttc
acacccaccagtcgatggagggacttggagaaggcagagctatcattagtgcctgcccca
agccggacccaatctgctcaccaaagcaggaggccacacttgcccatgtctcctagtacc
cagcagcctgccctgggaaagcagagacctatgagttcagtggagtttacctacagacca
cggacccgccgagttcccacaaagcccaagaaatctgcctcctttcctgtcactgggaca
tccatccgaaggctgacctggccctctttgcagatatcccctgcaaatattaagaagaag
gtgtaccacatggacatggaggcccagaggaagaacctgcagctcctgagtgaggagtct
gagttgaggctgccccactacctgcgcagcaaagcactggagctcaccaccaccaccatg
gagctgggcgcgctcaggctgcagtacctgtgccataagtacatcttctatagacgcctc
cagagcctccggcaagaagcgatcaaccatgtacaaatcatgaaagaaacggaggcttcc
tacaaggcccagaacctctacatcttcctggaaaacattgaccgcctgcagagtctcagg
ctgcaggcctggacggacaagcagaaggggctggaggagaagcaccgagagtgcctgagc
agcatggtgaccatgttccccaagctccagctggagtggaacgttcacctgaacatccct
gaggtcacctcgccaaagccaaagaaatgcaagttgcctgcagcctcaccccggcacatc
cgccccagtggccccacctacaagcagccctttctgtctaggcaccgggcatgtgtgccc
ctgcagatggcccgccaacaggggaagcagatggaggctgtctggaagaccgaggtggcc
tcctccagttacgcaatagaaaaaaagacccctgccagccttccccgggaccagctgagg
ggacacccagatattccccggctgttgacactggacgtgtag

DBGET integrated database retrieval system