KEGG   Homo sapiens (human): 84077
Entry
84077             CDS       T01001                                 
Symbol
C3orf20
Name
(RefSeq) chromosome 3 open reading frame 20
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FAM194
Other DBs
NCBI-GeneID: 84077
NCBI-ProteinID: NP_115513
HGNC: 25320
Ensembl: ENSG00000131379
Pharos: Q8ND61(Tdark)
UniProt: Q8ND61
Position
3:14675141..14773036
AA seq 904 aa
MSYIKSNLELYQQYTAMAPKLLARISKLLMICQNAGISVPKGIRNIFEFTWEELISDPSV
PTPSDILGLEVSFGAPLVVLMEPTFVQVPTLKKPLPPPPPAPPRPVLLATTGAAKRSTLS
PTMARQVRTHQETLNRFQQQSIHLLTELLRLKMKAMVESMSVGANPLDITRRFVEASQLL
HLNAKEMAFNCLISTAGRSGYSSGQLWKESLANMSAIGVNSPYQLIYHSSTACLSFSLSA
GKEAKKKIGKSRTTEDVSMPPLHRGVGTPANSLEFSDPCPEAREKLQELCRHIEAERATW
KGRNISYPMILRNYKAKMPSHLMLARKGDSQTPGLHYPPTAGAQTLSPTSHPSSANHHFS
QHCQEGKAPKKAFKFHYTFYDGSSFVYYPSGNVAVCQIPTCCRGRTITCLFNDIPGFSLL
ALFNTEGQGCVHYNLKTSCPYVLILDEEGGTTNDQQGYVVHKWSWTSRTETLLSLEYKVN
EEMKLKVLGQDSITVTFTSLNETVTLTVSANNCPHGMAYDKRLNRRISNMDDKVYKMSRA
LAEIKKRFQKTVTQFINSILLAAGLFTIEYPTKKEEEEFVRFKMRSRTHPERLPKLSLYS
GESLLRSQSGHLESSIAETLKDEPESAPVSPVRKTTKIHTKAKVTSRGKAREGRSPTRWA
ALPSDCPLVLRKLMLKEDTRAGCKCLVKAPLVSDVELERFLLAPRDPSQVLVFGIISSQN
YTSTGQLQWLLNTLYNHQQRGRGSPCIQCRYDSYRLLQYDLDSPLQEDPPLMVKKNSVVQ
GMILMFAGGKLIFGGRVLNGYGLSKQNLLKQIFRSQQDYKMGYFLPDDYKFSVPNSVLSL
EDSESVKKAESEDIQGSSSSLALEDYVEKELSLEAEKTREPEVELHPLSRDSKITSWKKQ
ASKK
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgagttacatcaagagtaacctagaattatatcagcaatacacagccatggcccccaag
ctactggcccgcatctccaaactcctcatgatctgccagaatgcaggcatttctgtacca
aaaggcatcagaaacatctttgagttcacttgggaagagctcatcagtgacccttcagtg
cctaccccgtccgacatcttgggcctggaggtcagctttggagcccccctggtggtgctc
atggaacccacctttgtgcaggtccccacactgaagaagccactacctccaccaccacca
gcaccaccacgtccagtgctgctggcaaccactggggcagccaagcgctccaccctctct
cccaccatggcccgtcaggtgcgcacccaccaggagaccctgaacaggtttcagcagcag
tccatccacctgctgacggagctcctcagactgaagatgaaggccatggtggagtctatg
tcggtgggtgccaaccccttggacatcaccaggcgctttgtggaggccagccagctcctc
cacctcaatgccaaggagatggccttcaactgcctgatcagcacagccgggagaagtggc
tacagcagcggacagttgtggaaagagtccctcgcaaacatgtccgccattggggtgaac
tcgccttaccagctgatctaccactcttccacagcctgtctgagcttttctctctctgct
ggaaaagaagccaagaagaaaataggcaaatctagaactacagaagatgtcagcatgccg
cccctgcatcgaggagtgggaacccctgccaacagcctggagttcagcgacccctgccct
gaggcccgggagaagctgcaggagttgtgtcgccacatagaagctgaaagggccacatgg
aaagggaggaatatctcctaccccatgatcttacgaaactacaaggcaaagatgccctct
catctaatgttggcccgcaaaggagactctcagaccccgggtttacattaccctcccact
gcaggtgctcagactctcagccccacctctcacccatcttctgccaaccatcatttcagt
cagcattgtcaagaggggaaggcacccaagaaggccttcaagtttcattacaccttctat
gatggctcctccttcgtttactatccctctggaaacgtcgctgtatgtcagatccccaca
tgctgcagagggagaaccatcacctgcctctttaatgacatacctggattctccttgctg
gccctattcaatactgaaggccagggctgtgttcactacaacctaaaaaccagttgccca
tatgtcttaatcttggatgaggaaggtgggaccaccaatgaccagcagggctatgtagtc
cacaagtggagctggacttccaggacagagaccctgctttccctggaatacaaggtgaat
gaggaaatgaaactaaaggtactgggacaggactccatcacagtcaccttcacctccctg
aatgagacagtaacactcactgtgtcggccaacaattgtccccatggaatggcatatgac
aaacggctgaaccgcagaatcagcaacatggacgacaaggtgtataagatgagccgagcc
ctggctgagatcaagaagcggtttcagaagacagtgactcagttcattaattctatcttg
ctggccgcaggtctgtttaccattgaatatcccaccaaaaaggaggaggaagaatttgtt
cggttcaagatgagatccagaactcatcccgagcggctccccaagctaagtttatactca
ggagaaagtcttttacgatctcagtcaggccacctggaatcctcaattgcagagactttg
aaggatgagcctgagtctgctcctgtgagcccagttcggaagaccaccaaaatccacacc
aaagccaaggtcacatccagagggaaggcccgcgaggggcgcagccccaccaggtgggcg
gccttgccctcagactgcccgctggtgctgcggaagctcatgctcaaggaagacacccgt
gctggctgcaagtgcctggtgaaggcgcccctggtctctgacgtggagctggagcgcttc
ctgttggcgccccgagaccccagccaagtgctggtgtttgggatcatctcaagccagaac
tacaccagcactgggcagctccagtggctgctgaacactctctacaaccaccagcagcgg
ggccgtggctccccctgcatccagtgccggtatgactcctaccgcctgctgcagtatgac
ctggacagccccctgcaggaggaccctcccctgatggtgaagaagaactctgtggtgcag
gggatgattctgatgtttgccggggggaagctcatttttgggggccgtgttttgaatgga
tatggcctcagcaagcagaatctgctgaaacagatcttccggtctcaacaggattacaag
atgggctacttcctgccggatgactacaaattcagtgttcccaactctgtcctgagcctg
gaggattctgaatcagtcaagaaagccgagtcagaagatatccaaggaagcagctcctca
ttggccctggaagactatgtggagaaggagttatctctggaggctgagaagacaagagag
cctgaagtggagctacatcctctcagcagggacagcaagataactagttggaagaagcag
gcctccaagaagtag

DBGET integrated database retrieval system