KEGG   Homo sapiens (human): 8408Help
Entry
8408              CDS       T01001                                 

Gene name
ULK1, ATG1, ATG1A, UNC51, Unc51.1, hATG1
Definition
(RefSeq) unc-51 like autophagy activating kinase 1
  KO
K21357  serine/threonine-protein kinase ULK1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    8408 (ULK1)
   04150 mTOR signaling pathway
    8408 (ULK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8408 (ULK1)
   04137 Mitophagy - animal
    8408 (ULK1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    8408 (ULK1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    8408 (ULK1)
   05017 Spinocerebellar ataxia
    8408 (ULK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8408 (ULK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8408 (ULK1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8408 (ULK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8408 (ULK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   8408 (ULK1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    8408 (ULK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    8408 (ULK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF3543 Kdo RIO1 Pkinase_fungal Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 8408
NCBI-ProteinID: NP_003556
OMIM: 603168
HGNC: 12558
Ensembl: ENSG00000177169
Vega: OTTHUMG00000168052
Pharos: O75385(Tchem)
UniProt: O75385
Structure
PDB: 

Position
12q24.33
AA seq 1050 aa AA seqDB search
MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLL
GKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQ
QIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAAT
LCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV
PTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGS
GSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMV
PAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGP
FSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSP
PAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSA
PEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCR
NLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRT
LPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESL
QEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPRTRMFSAGPTG
SASSSARHLVPGPCSEAPAPELPAPGHGCSFADPITANLEGAVTFEAPDLPEETLMEQEH
TEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQL
VLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRF
FLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHM
LSDQADIENVTKCKLCIERRLSALLTGICA
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggagcccggccgcggcggcacagagaccgtgggcaagttcgagttctcccgcaaggac
ctgatcggccacggcgccttcgcggtggtcttcaagggccgccaccgcgagaagcacgat
ttggaggtcgccgtcaagtgcattaacaagaagaacctcgccaagtctcagacgctgctg
gggaaggaaatcaaaatcctgaaggaactgaaacatgaaaacatcgtggccctgtacgac
ttccaggaaatggctaattctgtctacctggttatggagtactgcaacggtggggacctg
gccgactacctgcacgccatgcgcacgctgagcgaggacaccatcaggctcttcctgcag
cagatcgcgggcgccatgcggcttctgcacagcaaaggcatcatccaccgcgacctgaaa
ccgcagaacatcctgctgtccaaccccgccggccgccgcgccaaccccaacagcatccgc
gtcaagatcgctgacttcggcttcgcgcggtacctccagagcaacatgatggcggccaca
ctctgcggctcccccatgtacatggcccccgaggtcatcatgtcccagcactacgacggg
aaggcggacctgtggagcatcggcaccatcgtctaccagtgcctgacggggaaggcgccc
ttccaggccagcagcccccaggacctgcgcctgttctacgagaagaacaagacgttggtc
cccaccatcccccgggagacctcggccccgctgcggcagctgctcctggccctactgcaa
cgcaaccacaaggaccgcatggacttcgatgagttttttcatcaccctttcctcgatgcc
agcccctcggtcaggaaatccccacccgtgcctgtgccctcgtacccaagctcggggtcc
ggcagcagctccagcagcagctccacctcccacctggcctccccgccgtccctgggcgag
atgcagcagctgcagaagaccctggcctccccggctgacaccgctggcttcctgcacagc
tcccgggactctggtggcagcaaggactcttcctgtgacacagacgacttcgtcatggtc
cccgcgcagtttccaggtgacctggtggctgaggcgcccagtgccaaacccccgccagac
agcctgatgtgcagtgggagctcactggtggcctctgcgggcttggagagccacggccgg
accccatctccatccccaccctgcagcagctcccccagtccctcaggccgggctggcccg
ttctccagcagcaggtgcggcgcctctgtccccatcccagtccccacgcaggtgcagaac
taccagcgcattgagcgaaacctgcagtcacccacccagttccaaacacctcggtcctct
gccatccgcaggtcaggcagcaccagccccctgggctttgcaagggccagcccctcgccc
cctgcccacgctgagcatggaggcgtcctggccaggaagatgtctctgggtggaggccgg
ccctacacgccatctcctcaagttggaaccatccctgagcggccaggctggagcgggacg
ccctccccacagggagctgagatgcggggtggcaggtcccctcgtccaggctcctctgca
cccgagcactctccccgcacttccgggctgggctgccgcctgcacagcgcccccaacctg
tctgacttgcacgtcgtccgccccaagctgcccaaaccccccacggaccccctgggagct
gtgttcagcccaccacaggccagccctccccagccgtcccacggcctgcagtcctgccgg
aacctgcggggctcacccaagctgcccgacttcctgcagcgaaaccccctgccccccatc
ctgggctcccccaccaaggctgtgccctcctttgacttcccgaagacccccagctcccag
aacctgctggccctcctagcccggcagggcgtggtgatgacgccccctcgaaaccggacg
ctgcccgacctctcggaggtgggacccttccatggtcagccgttgggccctggcctgcgg
ccaggcgaggaccccaagggcccctttggccggtctttcagcaccagccgcctcactgac
ctgctccttaaggcggcgtttgggacacaagccccggacccgggcagcacggagagcctg
caggagaagcccatggagatcgcaccctcagctggctttggagggagcctgcacccagga
gcccgtgctgggggcaccagcagcccttccccggtggtcttcaccgtgggctctcccccg
agcgggagcacgcccccccagggcccccgcaccaggatgttctcagcgggccccactggc
tctgccagctcttctgcccgccacctggtgcctgggccctgcagcgaggccccagcccct
gagctccctgctccaggacacggctgcagctttgccgaccccattactgcgaacctggag
ggggctgtgaccttcgaggcccccgacctccctgaggagaccctcatggagcaagagcac
acggagatcctgcgtggcctgcgcttcacgctgctgttcgtgcagcacgtcctggagatc
gcagccctgaagggcagcgccagtgaggcggcggggggccctgagtaccagctgcaggag
agtgtggtggccgaccagatcagcctgctgagccgagaatggggcttcgcggaacagctg
gtgctgtacctgaaggtggccgagctactgtcctccggcctgcaaagtgccatcgaccag
atccgggccggcaagctctgcctgtcgtccactgtgaagcaggtggtgcgcaggctgaat
gagctgtacaaggccagcgtggtgtcctgccagggcctgagcctgcggctgcagcgcttc
ttcctggacaagcagcggctcctggaccgcattcacagcatcactgccgagaggctcatc
ttcagccacgctgtgcagatggtgcagtcggctgccctggacgagatgttccagcaccgt
gagggctgcgtcccacgctaccacaaggccctgctgctcctggaggggctgcagcacatg
ctctcggaccaggccgacatcgagaacgtcaccaagtgcaagctgtgcattgagcggaga
ctctcggcgctgctgactggcatctgtgcctga

DBGET integrated database retrieval system