KEGG   Homo sapiens (human): 8408Help
Entry
8408              CDS       T01001                                 

Gene name
ULK1, ATG1, ATG1A, UNC51, Unc51.1, hATG1
Definition
(RefSeq) unc-51 like autophagy activating kinase 1
  KO
K21357  serine/threonine-protein kinase ULK1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    8408 (ULK1)
   04150 mTOR signaling pathway
    8408 (ULK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8408 (ULK1)
   04137 Mitophagy - animal
    8408 (ULK1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    8408 (ULK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8408 (ULK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8408 (ULK1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8408 (ULK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8408 (ULK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   8408 (ULK1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    8408 (ULK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    8408 (ULK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF3543 Kdo RIO1 Pkinase_fungal Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 8408
NCBI-ProteinID: NP_003556
OMIM: 603168
HGNC: 12558
Ensembl: ENSG00000177169
Vega: OTTHUMG00000168052
Pharos: O75385(Tchem)
UniProt: O75385
Structure
PDB: 

Position
12q24.33
AA seq 1050 aa AA seqDB search
MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLL
GKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQ
QIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAAT
LCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV
PTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGS
GSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMV
PAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGP
FSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSP
PAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSA
PEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCR
NLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRT
LPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESL
QEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPRTRMFSAGPTG
SASSSARHLVPGPCSEAPAPELPAPGHGCSFADPIAANLEGAVTFEAPDLPEETLMEQEH
TEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQL
VLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRF
FLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHM
LSDQADIENVTKCKLCIERRLSALLTGICA
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggagcccggccgcggcggcacagagaccgtgggcaagttcgagttctcccgcaaggac
ctgatcggccacggcgccttcgcggtggtcttcaagggccgccaccgcgagaagcacgat
ttggaggtcgccgtcaagtgcattaacaagaagaacctcgccaagtctcagacgctgctg
gggaaggaaatcaaaatcctgaaggaactgaaacatgaaaacatcgtggccctgtacgac
ttccaggaaatggctaattctgtctacctggttatggagtactgcaacggtggggacctg
gccgactacctgcacgccatgcgcacgctgagcgaggacaccatcaggctcttcctgcag
cagatcgcgggcgccatgcggcttctgcacagcaaaggcatcatccaccgcgacctgaaa
ccgcagaacatcctgctgtccaaccccgccggccgccgcgccaaccccaacagcatccgc
gtcaagatcgctgacttcggcttcgcgcggtacctccagagcaacatgatggcggccaca
ctctgcggctcccccatgtacatggcccccgaggtcatcatgtcccagcactacgacggg
aaggcggacctgtggagcatcggcaccatcgtctaccagtgcctgacggggaaggcgccc
ttccaggccagcagcccccaggacctgcgcctgttctacgagaagaacaagacgttggtc
cccaccatcccccgggagacctcggccccgctgcggcagctgctcctggccctactgcaa
cgcaaccacaaggaccgcatggacttcgatgagttttttcatcaccctttcctcgatgcc
agcccctcggtcaggaaatccccacccgtgcctgtgccctcgtacccaagctcggggtcc
ggcagcagctccagcagcagctccacctcccacctggcctccccgccgtccctgggcgag
atgcagcagctgcagaagaccctggcctccccggctgacaccgctggcttcctgcacagc
tcccgggactctggtggcagcaaggactcttcctgtgacacagacgacttcgtcatggtc
cccgcgcagtttccaggtgacctggtggctgaggcgcccagtgccaaacccccgccagac
agcctgatgtgcagtgggagctcactggtggcctctgcgggcttggagagccacggccgg
accccatctccatccccaccctgcagcagctcccccagtccctcaggccgggctggcccg
ttctccagcagcaggtgcggcgcctctgtccccatcccagtccccacgcaggtgcagaac
taccagcgcattgagcgaaacctgcagtcacccacccagttccaaacacctcggtcctct
gccatccgcaggtcaggcagcaccagccccctgggctttgcaagggccagcccctcgccc
cctgcccacgctgagcatggaggcgtcctggccaggaagatgtctctgggtggaggccgg
ccctacacgccatctcctcaagttggaaccatccctgagcggccaggctggagcgggacg
ccctccccacagggagctgagatgcggggtggcaggtcccctcgtccaggctcctctgca
cccgagcactctccccgcacttccgggctgggctgccgcctgcacagcgcccccaacctg
tctgacttgcacgtcgtccgccccaagctgcccaaaccccccacggaccccctgggagct
gtgttcagcccaccacaggccagccctccccagccgtcccacggcctgcagtcctgccgg
aacctgcggggctcacccaagctgcccgacttcctgcagcgaaaccccctgccccccatc
ctgggctcccccaccaaggctgtgccctcctttgacttcccgaagacccccagctcccag
aacctgctggccctcctagcccggcagggcgtggtgatgacgccccctcgaaaccggacg
ctgcccgacctctcggaggtgggacccttccatggtcagccgttgggccctggcctgcgg
ccaggcgaggaccccaagggcccctttggccggtctttcagcaccagccgcctcactgac
ctgctccttaaggcggcgtttgggacacaagccccggacccgggcagcacggagagcctg
caggagaagcccatggagatcgcaccctcagctggctttggagggagcctgcacccagga
gcccgtgctgggggcaccagcagcccttccccggtggtcttcaccgtgggctctcccccg
agcgggagcacgcccccccagggcccccgcaccaggatgttctcagcgggccccactggc
tctgccagctcttctgcccgccacctggtgcctgggccctgcagcgaggccccagcccct
gagctccctgctccaggacacggctgcagctttgccgaccccattgctgcgaacctggag
ggggctgtgaccttcgaggcccccgacctccctgaggagaccctcatggagcaagagcac
acggagatcctgcgtggcctgcgcttcacgctgctgttcgtgcagcacgtcctggagatc
gcagccctgaagggcagcgccagtgaggcggcggggggccctgagtaccagctgcaggag
agtgtggtggccgaccagatcagcctgctgagccgagaatggggcttcgcggaacagctg
gtgctgtacctgaaggtggccgagctactgtcctccggcctgcaaagtgccatcgaccag
atccgggccggcaagctctgcctgtcgtccactgtgaagcaggtggtgcgcaggctgaat
gagctgtacaaggccagcgtggtgtcctgccagggcctgagcctgcggctgcagcgcttc
ttcctggacaagcagcggctcctggaccgcattcacagcatcactgccgagaggctcatc
ttcagccacgctgtgcagatggtgcagtcggctgccctggacgagatgttccagcaccgt
gagggctgcgtcccacgctaccacaaggccctgctgctcctggaggggctgcagcacatg
ctctcggaccaggccgacatcgagaacgtcaccaagtgcaagctgtgcattgagcggaga
ctctcggcgctgctgactggcatctgtgcctga

KEGG   Homo sapiens (human): 9706Help
Entry
9706              CDS       T01001                                 

Gene name
ULK2, ATG1B, Unc51.2
Definition
(RefSeq) unc-51 like autophagy activating kinase 2
  KO
K08269  serine/threonine-protein kinase ULK2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    9706 (ULK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9706 (ULK2)
   04136 Autophagy - other
    9706 (ULK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9706 (ULK2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9706 (ULK2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9706 (ULK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9706 (ULK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   9706 (ULK2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg1 complex
    9706 (ULK2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    9706 (ULK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF3543 Kdo RIO1 Pkinase_fungal Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 9706
NCBI-ProteinID: NP_001136082
OMIM: 608650
HGNC: 13480
Ensembl: ENSG00000083290
Vega: OTTHUMG00000059511
Pharos: Q8IYT8(Tchem)
UniProt: Q8IYT8
Structure
PDB: 

Position
17p11.2
AA seq 1036 aa AA seqDB search
MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKIL
KELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMR
ILHSKGIIHRDLKPQNILLSYANRRKSSVSGIRIKIADFGFARYLHSNMMAATLCGSPMY
MAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRET
SPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQGPVKKSCPVPVPMYSGSVSGSSCGSSP
SCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASTSSKNSSCDTDDFVLVPHNI
SSDHSCDMPVGTAGRRASNEFLVCGGQCQPTVSPHSETAPIPVPTQIRNYQRIEQNLTST
ASSGTNVHGSPRSAVVRRSNTSPMGFLRPGSCSPVPADTAQTVGRRLSTGSSRPYSPSPL
VGTIPEQFSQCCCGHPQGHDSRSRNSSGSPVPQAQSPQSLLSGARLQSAPTLTDIYQNKQ
KLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTSPTKHLGSSPRSSDWFFKTPLPTIIGS
PTKTTAPFKIPKTQASSNLLALVTRHGPAEEQSKDGNEPRECAHCLLVQGSERQRAEQQS
KAVFGRSVSTGKLSDQQGKTPICRHQGSTDSLNTERPMDIAPAGACGGVLAPPAGTAASS
KAVLFTVGSPPHSAAAPTCTHMFLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSS
PPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECV
LDLTAMRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLH
LAKAQIKSGKLSPSTAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVT
AEKLIYNCAVEMVQSAALDEMFQQTEDIVYRYHKAALLLEGLSRILQDPADIENVHKYKC
SIERRLSALCHSTATV
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtgggtgacttcgagtacagcaagagggatctcgtgggacacggggccttc
gccgtggtcttccgggggcggcaccgccagaaaactgattgggaggtagctattaaaagt
attaataaaaagaacttgtcaaaatcacaaatactgcttggaaaggaaattaaaatctta
aaggaacttcagcatgaaaatattgtagcactctatgatgttcaggaattacccaactct
gtctttttggtgatggagtattgcaatggtggagacctcgcagattatttgcaagcgaaa
gggactctcagtgaagacacgatcagagtgtttctgcatcagattgctgctgccatgcga
atcctgcacagcaaaggaatcatccacagagatctcaaaccacagaacatcttgctgtcc
tatgccaatcgcagaaaatcaagtgtcagtggtattcgcatcaaaatagcggattttggt
tttgctcgttacctacatagtaacatgatggctgcaacactgtgtggatccccgatgtac
atggctcctgaggttattatgtctcaacattatgatgctaaggctgacttgtggagcata
ggaacagtgatataccaatgcctagttggaaaaccaccttttcaggccaatagtcctcaa
gacttaaggatgttttatgaaaaaaacaggagcttaatgcctagtattcccagagaaaca
tcaccttatttggctaatctccttttgggtttgcttcagagaaaccaaaaagatagaatg
gactttgaagcattttttagccatccttttcttgagcaaggtccagtaaaaaaatcttgc
ccagttccagtgcccatgtattctggttctgtctctggaagctcctgtggcagctctcca
tcttgtcgttttgcttctccaccatcccttccagatatgcagcatattcaggaagaaaac
ttatcttccccaccattgggtcctcccaactatctacaagtttccaaagattctgccagt
actagtagcaagaactcttcttgtgacacggatgactttgttttggtgccacacaacatc
tcgtcagaccactcatgtgatatgccagtggggactgctggcagacgtgcttcaaatgaa
ttcttggtgtgtggagggcagtgtcagcctactgtgtcacctcacagcgaaacagcacca
attccagttcctactcaaataaggaattatcagcgcatagagcagaatcttacatctact
gccagctcaggcacaaatgtacatggttctccaagatctgcagtggtacgaaggtccaac
accagccccatgggcttcctccggccgggatcatgctccccagtaccagcagacacagca
cagacagttggacgaaggctctccactgggtcttctaggccttactcaccttcccctttg
gttggtaccattcctgagcaattcagtcagtgctgctgtgggcatcctcagggccatgac
tccaggagtagaaactcctcaggttctccagtgccacaagctcagtccccacagtctctc
ttatcgggtgctagactgcagagcgcccccaccctcactgacatctatcagaacaagcag
aagctcagaaaacagcactctgaccccgtgtgcccatcccatactggggctgggtacagc
tactcgcctcagcccagtcggcctggcagccttggaacttctcccaccaagcacttgggg
tcctctccacggagttctgactggttctttaaaactcctttgccaacaatcattggctct
cctactaagaccacagctcctttcaaaatccctaaaactcaagcatcttccaacctgtta
gccttggttactcgtcatgggcctgctgaagaacagtcgaaagatgggaatgagccacgg
gaatgtgcccattgcctcttagtgcaaggaagtgagaggcagcgggccgagcagcagagc
aaggcagtgtttggcagatctgtcagtaccgggaagttatcagatcaacaaggaaagact
cctatatgtcgacatcagggcagcacagacagtttaaatacagaacgaccaatggatata
gctccggcaggagcctgtggtggtgttctggcacctcctgcaggtacagcagcaagttcc
aaggctgtcctcttcactgtagggtctcctccacacagtgcggcagcccccacttgtacc
cacatgttccttcgaacaagaacaacctcagtggggcccagcaactccgggggctctctt
tgtgccatgagtggccgcgtgtgcgtggggtccccgcctggcccaggcttcggctcttcc
cctccaggagcagaggcagctcccagcctgagatacgtgccttacggtgcttcacccccc
agcctagaggggctcatcacctttgaagcccctgaactgccggaggagacgctgatggag
cgggaacacacagacaccttacgccatctgaatgtgatgctgatgttcactgagtgtgtg
ctggacctgacagccatgaggggaggaaaccctgagctgtgcacatctgctgtgtccttg
taccagatccaggagagtgtggtggtggaccagatcagtcagctgagcaaagactggggg
cgggtggagcagctggtgttgtacatgaaagcagcacagctgcttgcggcttctctgcat
cttgccaaagcccagatcaagtccgggaaactgagcccatccacagctgtgaaacaagtt
gtcaagaatctgaacgaacgatataaattctgcatcaccatgtgcaagaaacttacagaa
aagctgaatcgattcttctctgacaaacagaggtttattgatgaaatcaacagtgtgact
gcagagaaactcatctataattgtgctgtagaaatggttcagtctgcagccctggatgag
atgtttcagcagaccgaagatattgtttatcgctatcataaggcagcccttcttttggaa
ggcctaagtaggattctacaggaccctgcagatattgaaaatgtgcataaatataaatgt
agtattgagagaagactgtcggcgctctgccatagcaccgcaaccgtgtga

DBGET integrated database retrieval system