KEGG   Homo sapiens (human): 8408
Entry
8408              CDS       T01001                                 

Gene name
ULK1, ATG1, ATG1A, UNC51, Unc51.1, hATG1
Definition
(RefSeq) unc-51 like autophagy activating kinase 1
  KO
K21357  serine/threonine-protein kinase ULK1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06464  Amyotrophic lateral sclerosis
  Element
N00155  Autophagy-vesicle nucleation
N01142  C9orf72-mediated autophagy initiation
N01143  Mutation-inactivated C9orf72 to C9orf72-mediated autophagy initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    8408 (ULK1)
   04150 mTOR signaling pathway
    8408 (ULK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8408 (ULK1)
   04137 Mitophagy - animal
    8408 (ULK1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    8408 (ULK1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    8408 (ULK1)
   05014 Amyotrophic lateral sclerosis
    8408 (ULK1)
   05016 Huntington disease
    8408 (ULK1)
   05017 Spinocerebellar ataxia
    8408 (ULK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8408 (ULK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8408 (ULK1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8408 (ULK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8408 (ULK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   8408 (ULK1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    8408 (ULK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    8408 (ULK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF3543 Kdo RIO1 Pkinase_fungal APH Kinase-like
Other DBs
NCBI-GeneID: 8408
NCBI-ProteinID: NP_003556
OMIM: 603168
HGNC: 12558
Ensembl: ENSG00000177169
Vega: OTTHUMG00000168052
Pharos: O75385(Tchem)
UniProt: O75385
Structure
PDB: 
4WNO 6MNH 5CI7 6QAS 4WNP

Position
12q24.33
AA seq 1050 aa
MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLL
GKEIKILKELKHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQ
QIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAAT
LCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV
PTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGS
GSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMV
PAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGP
FSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSP
PAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSA
PEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCR
NLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRT
LPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESL
QEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPRTRMFSAGPTG
SASSSARHLVPGPCSEAPAPELPAPGHGCSFADPITANLEGAVTFEAPDLPEETLMEQEH
TEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQL
VLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRF
FLDKQRLLDRIHSITAERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHM
LSDQADIENVTKCKLCIERRLSALLTGICA
NT seq 3153 nt   +upstreamnt  +downstreamnt
atggagcccggccgcggcggcacagagaccgtgggcaagttcgagttctcccgcaaggac
ctgatcggccacggcgccttcgcggtggtcttcaagggccgccaccgcgagaagcacgat
ttggaggtcgccgtcaagtgcattaacaagaagaacctcgccaagtctcagacgctgctg
gggaaggaaatcaaaatcctgaaggaactgaaacatgaaaacatcgtggccctgtacgac
ttccaggaaatggctaattctgtctacctggttatggagtactgcaacggtggggacctg
gccgactacctgcacgccatgcgcacgctgagcgaggacaccatcaggctcttcctgcag
cagatcgcgggcgccatgcggcttctgcacagcaaaggcatcatccaccgcgacctgaaa
ccgcagaacatcctgctgtccaaccccgccggccgccgcgccaaccccaacagcatccgc
gtcaagatcgctgacttcggcttcgcgcggtacctccagagcaacatgatggcggccaca
ctctgcggctcccccatgtacatggcccccgaggtcatcatgtcccagcactacgacggg
aaggcggacctgtggagcatcggcaccatcgtctaccagtgcctgacggggaaggcgccc
ttccaggccagcagcccccaggacctgcgcctgttctacgagaagaacaagacgttggtc
cccaccatcccccgggagacctcggccccgctgcggcagctgctcctggccctactgcaa
cgcaaccacaaggaccgcatggacttcgatgagttttttcatcaccctttcctcgatgcc
agcccctcggtcaggaaatccccacccgtgcctgtgccctcgtacccaagctcggggtcc
ggcagcagctccagcagcagctccacctcccacctggcctccccgccgtccctgggcgag
atgcagcagctgcagaagaccctggcctccccggctgacaccgctggcttcctgcacagc
tcccgggactctggtggcagcaaggactcttcctgtgacacagacgacttcgtcatggtc
cccgcgcagtttccaggtgacctggtggctgaggcgcccagtgccaaacccccgccagac
agcctgatgtgcagtgggagctcactggtggcctctgcgggcttggagagccacggccgg
accccatctccatccccaccctgcagcagctcccccagtccctcaggccgggctggcccg
ttctccagcagcaggtgcggcgcctctgtccccatcccagtccccacgcaggtgcagaac
taccagcgcattgagcgaaacctgcagtcacccacccagttccaaacacctcggtcctct
gccatccgcaggtcaggcagcaccagccccctgggctttgcaagggccagcccctcgccc
cctgcccacgctgagcatggaggcgtcctggccaggaagatgtctctgggtggaggccgg
ccctacacgccatctcctcaagttggaaccatccctgagcggccaggctggagcgggacg
ccctccccacagggagctgagatgcggggtggcaggtcccctcgtccaggctcctctgca
cccgagcactctccccgcacttccgggctgggctgccgcctgcacagcgcccccaacctg
tctgacttgcacgtcgtccgccccaagctgcccaaaccccccacggaccccctgggagct
gtgttcagcccaccacaggccagccctccccagccgtcccacggcctgcagtcctgccgg
aacctgcggggctcacccaagctgcccgacttcctgcagcgaaaccccctgccccccatc
ctgggctcccccaccaaggctgtgccctcctttgacttcccgaagacccccagctcccag
aacctgctggccctcctagcccggcagggcgtggtgatgacgccccctcgaaaccggacg
ctgcccgacctctcggaggtgggacccttccatggtcagccgttgggccctggcctgcgg
ccaggcgaggaccccaagggcccctttggccggtctttcagcaccagccgcctcactgac
ctgctccttaaggcggcgtttgggacacaagccccggacccgggcagcacggagagcctg
caggagaagcccatggagatcgcaccctcagctggctttggagggagcctgcacccagga
gcccgtgctgggggcaccagcagcccttccccggtggtcttcaccgtgggctctcccccg
agcgggagcacgcccccccagggcccccgcaccaggatgttctcagcgggccccactggc
tctgccagctcttctgcccgccacctggtgcctgggccctgcagcgaggccccagcccct
gagctccctgctccaggacacggctgcagctttgccgaccccattactgcgaacctggag
ggggctgtgaccttcgaggcccccgacctccctgaggagaccctcatggagcaagagcac
acggagatcctgcgtggcctgcgcttcacgctgctgttcgtgcagcacgtcctggagatc
gcagccctgaagggcagcgccagtgaggcggcggggggccctgagtaccagctgcaggag
agtgtggtggccgaccagatcagcctgctgagccgagaatggggcttcgcggaacagctg
gtgctgtacctgaaggtggccgagctactgtcctccggcctgcaaagtgccatcgaccag
atccgggccggcaagctctgcctgtcgtccactgtgaagcaggtggtgcgcaggctgaat
gagctgtacaaggccagcgtggtgtcctgccagggcctgagcctgcggctgcagcgcttc
ttcctggacaagcagcggctcctggaccgcattcacagcatcactgccgagaggctcatc
ttcagccacgctgtgcagatggtgcagtcggctgccctggacgagatgttccagcaccgt
gagggctgcgtcccacgctaccacaaggccctgctgctcctggaggggctgcagcacatg
ctctcggaccaggccgacatcgagaacgtcaccaagtgcaagctgtgcattgagcggaga
ctctcggcgctgctgactggcatctgtgcctga

KEGG   Homo sapiens (human): 9821
Entry
9821              CDS       T01001                                 

Gene name
RB1CC1, ATG17, CC1, FIP200, PPP1R131
Definition
(RefSeq) RB1 inducible coiled-coil 1
  KO
K17589  RB1-inducible coiled-coil protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06464  Amyotrophic lateral sclerosis
  Element
N00155  Autophagy-vesicle nucleation
N01142  C9orf72-mediated autophagy initiation
N01143  Mutation-inactivated C9orf72 to C9orf72-mediated autophagy initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9821 (RB1CC1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    9821 (RB1CC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9821 (RB1CC1)
   05014 Amyotrophic lateral sclerosis
    9821 (RB1CC1)
   05016 Huntington disease
    9821 (RB1CC1)
   05017 Spinocerebellar ataxia
    9821 (RB1CC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9821 (RB1CC1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9821 (RB1CC1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9821 (RB1CC1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9821 (RB1CC1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    9821 (RB1CC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    9821 (RB1CC1)
SSDB
Motif
Pfam: ATG11 TBK1_ULD Jag_N
Other DBs
NCBI-GeneID: 9821
NCBI-ProteinID: NP_055596
OMIM: 606837
HGNC: 15574
Ensembl: ENSG00000023287
Vega: OTTHUMG00000164268
Pharos: Q8TDY2(Tbio)
UniProt: Q8TDY2
Structure
PDB: 
6DCE 6GMA

Position
8q11.23
AA seq 1594 aa
MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVC
TYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQ
LALEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQ
SIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAEMKRSTEL
VLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRESCQSTVHQQDETTIDTKDGD
LPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQTIAKLDNQNMK
AIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQL
MIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELL
ERVKIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGK
LFRKSFLRNRLFRGLDSWPPSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVP
LLCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLSEQKASVSQTSPQSASSPRMESTA
GITTTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTFDFETIPHPNIEQTIHQVSLD
LDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDT
NVCGKEDFGDHTSLNVQLERCRVVAQDSHFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCT
AVEIRNIIEKVKCSLEITLKEKHQKELLSLKNEYEGKLDGLIKETEENENKIKKLKGELV
CLEEVLQNKDNEFALVKHEKEAVICLQNEKDQKLLEMENIMHSQNCEIKELKQSREIVLE
DLKKLHVENDEKLQLLRAELQSLEQSHLKELEDTLQVRHIQEFEKVMTDHRVSLEELKKE
NQQIINQIQESHAEIIQEKEKQLQELKLKVSDLSDTRCKLEVELALKEAETDEIKILLEE
SRAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQVGLAELRTLMTIEKDQCISEL
ISRHEEESNILKAELNKVTSLHNQAFEIEKNLKEQIIELQSKLDSELSALERQKDEKITQ
QEEKYEAIIQNLEKDRQKLVSSQEQDREQLIQKLNCEKDEAIQTALKEFKLEREVVEKEL
LEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNV
RTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLE
EKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMET
SMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRD
FQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVM
EKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
NT seq 4785 nt   +upstreamnt  +downstreamnt
atgaagttatatgtatttctggttaacactggaactactctaacatttgacactgaactt
acagtgcaaactgtggcagaccttaagcatgccattcaaagcaaatacaagattgctatt
caacaccaggtgctggtggtcaatggaggagaatgcatggctgcagatcgaagagtgtgt
acctacagtgctgggacggatacaaatccaatttttctttttaacaaagaaatgatctta
tgtgatcgtccacctgctattcctaaaactaccttttcgacagaaaatgacatggaaata
aaagttgaagaatctcttatgatgcctgcagtttttcatactgttgcttcaaggacacag
cttgcattggaaatgtatgaagttgccaagaaactttgttctttttgtgaaggtcttgta
catgatgaacatcttcaacaccaaggctgggctgcaatcatggccaacctggaggactgt
tcaaattcataccaaaagctacttttcaagtttgaaagtatttattcaaattatctgcag
tccatagaagacatcaagttaaaacttactcatttaggaactgcagtttcagtaatggcc
aagattccactgttggagtgcctaaccagacatagttacagagaatgtttgggaagactg
gattctttacctgaacatgaagactcagaaaaagctgagatgaaaagatccactgaactg
gtgctctctcctgatatgcctagaacaactaacgaatctttgttaacctcatttcccaag
tcagtggaacatgtgtccccagataccgcagatgctgaaagtggcaaagaaattagggaa
tcttgtcaaagtactgttcatcagcaagatgaaactacgattgacactaaagatggtgat
ctgcccttttttaatgtctctttgttagactggataaatgttcaagatagacctaatgat
gtggaatctttggtcaggaagtgctttgattctatgagcaggcttgatccaaggattatt
cgaccatttatagcagaatgccgtcaaactattgccaaacttgataatcagaatatgaaa
gccattaaaggacttgaagatcggctctacgccctggaccagatgattgctagctgtggc
cgactggtgaatgaacagaaagagcttgctcagggatttttagctaatcagaagagagct
gaaaacttaaaggatgcatctgtattacctgatttatgcctgagtcacgcaaatcagttg
atgattatgttgcaaaatcatagaaaactgttagatattaagcagaagtgtaccactgcc
aaacaagaactagcaaataacctacatgtcagactgaagtggtgttgctttgtaatgctt
catgctgatcaagatggagagaagttacaagctttgctccgcctcgtaatagagctgtta
gaaagagtcaaaattgttgaagctcttagtacagttcctcagatgtactgcttagctgtt
gttgaggttgtaagaagaaaaatgttcataaaacactacagggagtgggctggtgcttta
gtcaaagatggaaagagattatatgaagcagaaaaatcaaaaagggaatcctttgggaaa
ttatttaggaagtcttttttaagaaatcgtctgtttaggggactggactcctggccccct
tccttttgtactcaaaagcctcgaaagtttgactgtgaacttccagatatttcattaaaa
gatttacagtttctgcaatcattttgtccttcggaagttcagccattcctcagggttccc
ttactttgtgactttgaacctctacaccagcatgtacttgctctacataatttggtaaaa
gcagcacaaagtttggatgaaatgtcacagaccattacagatctactgagtgaacaaaag
gcatctgtgagtcagacatccccacagtctgcttcttcaccaaggatggaaagtacagca
ggaattacaactactacctcaccgagaactcctccaccactgactgttcaggatccctta
tgtcctgcagtttgtcccttagaagaattatctccagatagtattgatgcacatacgttt
gattttgaaactattccccatccaaacatagaacagactattcaccaagtttctttagac
ttggattcattagcagaaagtcctgaatcagattttatgtctgctgtgaatgagtttgta
atagaagaaaatttgtcgtctcctaatcctataagtgatccacaaagcccagaaatgatg
gtggaatcactttattcatcagttatcaatgcgatagacagtagacgaatgcaggataca
aatgtatgtggtaaggaggattttggagatcatacttctctgaatgtccagttggaaaga
tgtagagttgttgcccaagactctcacttcagtatacaaaccattaaggaagacctttgc
cactttagaacatttgtacaaaaagaacagtgtgacttctcaaattcattaaaatgtaca
gcagtagaaataagaaacattattgaaaaagtaaaatgttctctggaaataacactaaaa
gaaaaacatcaaaaagaactactgtctttaaaaaatgaatatgaaggtaaacttgacgga
ctaataaaggaaactgaagagaatgaaaacaaaattaaaaaattgaagggagagttagta
tgccttgaggaggttttacaaaataaagataatgaatttgctttggttaaacatgaaaaa
gaagctgtaatctgcctgcagaatgaaaaggatcagaagttgttagagatggaaaatata
atgcactctcaaaattgtgaaattaaagaactgaagcagtcacgagaaatagtgttagaa
gacttaaaaaagctccatgttgaaaatgatgagaagttacagttattgagggcagaactt
cagtccttggagcaaagtcatctaaaggaattagaggacacacttcaggttaggcacata
caagagtttgagaaggttatgacagaccacagagtttctttggaggaattaaaaaaggaa
aaccaacaaataattaatcaaatacaagaatctcatgctgaaattatccaggaaaaagaa
aaacagttacaggaattaaaactcaaggtttctgatttgtcagacacgagatgcaagtta
gaggttgaacttgcgttgaaggaagcagaaactgatgaaataaaaattttgctggaagaa
agcagagcccagcagaaggagaccttgaaatctcttcttgaacaagagacagaaaatttg
agaacagaaattagtaaactcaaccaaaagattcaggataataatgaaaattatcaggtg
ggcttagcagagctaagaactttaatgacaattgaaaaagatcagtgtatttccgagtta
attagtagacatgaagaagaatctaatatacttaaagctgaattaaacaaagtaacatct
ttgcataaccaagcatttgaaatagaaaaaaacctaaaagaacaaataattgaactgcag
agtaaattggattcagaattgagtgctcttgaaagacaaaaagatgaaaaaattacccaa
caagaagagaaatacgaagctattatccagaaccttgagaaagacagacaaaaattggtc
agcagccaggagcaagacagagaacagttaattcagaagcttaattgtgaaaaagatgaa
gctattcagactgccctaaaagaatttaaattggagagagaagttgttgagaaagagtta
ttagaaaaagttaaacatcttgagaatcaaatagcaaaaagtcctgccattgactctacc
agaggagattcttcaagcttagttgctgaacttcaagaaaagcttcaggaagaaaaagct
aagtttctagaacaacttgaagagcaagaaaaaagaaagaatgaagaaatgcaaaatgtt
cgaacatctttgattgcggaacaacagaccaattttaacactgttttaacaagagagaaa
atgagaaaagaaaacataataaatgatcttagtgataagttgaaaagtacaatgcagcaa
caagaacgggataaagatttgatagagtcactttctgaagatcgagctcgtttgcttgag
gaaaagaaaaagcttgaagaagaagtcagtaagttgcgtagtagcagttttgttccttca
ccatatgtagctacagccccagaactttatggagcttgtgcacctgaactcccaggtgaa
tcagatagatccgctgtggaaacagcagatgaaggaagagtggattcagcaatggagaca
agcatgatgtctgtacaagaaaatattcatatgttgtctgaagaaaaacagcggataatg
ctgttagaacgaacattgcaattgaaagaagaagaaaataaacggttaaatcaaagactg
atgtctcagagcatgtcttcagtatcttcaaggcattctgaaaagatagctattagagat
tttcaggtgggagatttggtactcatcatcctagacgaacgccatgacaattatgtgtta
tttactgttagtcctactttatattttctacattcagagtctctacctgccctggatctc
aaaccaggtgagggtgcttcaggtgcatctagaagaccctgggtacttggaaaagtaatg
gaaaaagaatactgtcaagccaaaaaggcacaaaacagatttaaagttcctttggggaca
aagttttacagagtgaaagccgtatcatggaataagaaagtataa

KEGG   Homo sapiens (human): 60673
Entry
60673             CDS       T01001                                 

Gene name
ATG101, C12orf44
Definition
(RefSeq) autophagy related 101
  KO
K19730  autophagy-related protein 101
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06464  Amyotrophic lateral sclerosis
  Element
N00155  Autophagy-vesicle nucleation
N01142  C9orf72-mediated autophagy initiation
N01143  Mutation-inactivated C9orf72 to C9orf72-mediated autophagy initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    60673 (ATG101)
   04136 Autophagy - other
    60673 (ATG101)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    60673 (ATG101)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    60673 (ATG101)
   05014 Amyotrophic lateral sclerosis
    60673 (ATG101)
   05016 Huntington disease
    60673 (ATG101)
   05017 Spinocerebellar ataxia
    60673 (ATG101)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    60673 (ATG101)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    60673 (ATG101)
SSDB
Motif
Pfam: ATG101
Other DBs
NCBI-GeneID: 60673
NCBI-ProteinID: NP_001092143
OMIM: 615089
HGNC: 25679
Ensembl: ENSG00000123395
Vega: OTTHUMG00000169611
Pharos: Q9BSB4(Tbio)
UniProt: Q9BSB4 A0A024R128
Structure
PDB: 

Position
12q13.13
AA seq 218 aa
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFI
DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE
VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDT
GLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgaactgtcgctcggaggtgctggaggtgtcggtggaggggcggcaggtggaggaggcc
atgctggctgtgctgcacacggtgcttctgcaccgcagcacaggcaagttccactacaag
aaggagggcacctactccattggcaccgtgggcacccaggatgttgactgtgacttcatc
gacttcacttatgtgcgtgtctcttctgaggaactggatcgtgccctgcgcaaggttgtt
ggggagttcaaggatgcactgcgcaactctggtggcgatgggctggggcagatgtccttg
gagttctaccagaagaagaagtctcgctggccattctcagacgagtgcatcccatgggaa
gtgtggacggtcaaggtgcatgtggtagccctggccacggagcaggagcggcagatctgc
cgggagaaggtgggtgagaaactctgcgagaagatcatcaacatcgtggaggtgatgaat
cggcatgagtacttgcccaagatgcccacacagtcggaggtggataacgtgtttgacaca
ggcttgcgggacgtgcagccctacctgtacaagatctccttccagatcactgatgccctg
ggcacctcagtcaccaccaccatgcgcaggctcatcaaagacacccttgccctctga

KEGG   Homo sapiens (human): 9776
Entry
9776              CDS       T01001                                 

Gene name
ATG13, KIAA0652, PARATARG8
Definition
(RefSeq) autophagy related 13
  KO
K08331  autophagy-related protein 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06464  Amyotrophic lateral sclerosis
  Element
N00155  Autophagy-vesicle nucleation
N01142  C9orf72-mediated autophagy initiation
N01143  Mutation-inactivated C9orf72 to C9orf72-mediated autophagy initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9776 (ATG13)
   04136 Autophagy - other
    9776 (ATG13)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    9776 (ATG13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9776 (ATG13)
   05014 Amyotrophic lateral sclerosis
    9776 (ATG13)
   05016 Huntington disease
    9776 (ATG13)
   05017 Spinocerebellar ataxia
    9776 (ATG13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9776 (ATG13)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    9776 (ATG13)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    9776 (ATG13)
   Atg1 complex
    9776 (ATG13)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    9776 (ATG13)
SSDB
Motif
Pfam: ATG13
Other DBs
NCBI-GeneID: 9776
NCBI-ProteinID: NP_001136145
OMIM: 615088
HGNC: 29091
Ensembl: ENSG00000175224
Vega: OTTHUMG00000166538
Pharos: O75143(Tbio)
UniProt: O75143 A8K0S6
Structure
PDB: 

Position
11p11.2
AA seq 517 aa
METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPE
VTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNR
LSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPV
GTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGV
IYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQ
LMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRA
SPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETE
SPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLS
IDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggaaactgatctcaattcccaggacagaaaggacctggacaagtttattaaatttttt
gccctcaagactgtccaagtgattgtccaggctcggcttggtgaaaagatttgcactcgt
tcatcatcttctccaacgggttcagattggttcaacttagcaatcaaagacatcccagag
gttacacatgaagcaaagaaggcactggcaggacagctgcctgcagtcgggaggtccatg
tgtgtggagatttcacttaagacttctgagggagattccatggagctggaaatatggtgt
cttgaaatgaatgaaaagtgtgataaagaaatcaaagtttcctacacggtgtacaacaga
ctgtcattgctgctgaagtcccttcttgctataactagggtgacaccagcctataggctc
tccaggaaacaagggcatgaatatgtcatattatacaggatatattttggagaagttcag
ctgagtggcttaggagaaggcttccagacagttcgtgttgggacagtgggcacccctgtg
ggcaccatcactctttcttgtgcttacagaattaacttggcattcatgtctaccaggcaa
tttgagaggaccccacctatcatggggattattattgatcactttgtggaccgtccctat
cccagctcctctcccatgcacccctgcaattacagaactgctggtgaggacactggagta
atatacccgtctgtagaagactctcaagaagtgtgtaccacctctttttccacctcccca
ccatcccagctctcaagctctcgcctttcctatcagcctgctgccctgggcgttggatca
gctgacctggcttatccagtagtgtttgctgctggcttaaatgctacacaccctcaccag
ctgatggttcctgggaaggaaggtggggtaccccttgctcccaaccagcctgtccatggt
acccaggctgaccaggagagactggcaacctgcaccccttctgacagaacccactgtgct
gccacaccctccagtagtgaggatactgaaaccgtatcaaacagcagtgagggacgggcc
tcccctcacgatgtcttggagaccatctttgtccgaaaagtgggggcttttgtcaacaaa
cccattaaccaggtgaccctgacgagtttggatataccctttgccatgtttgctcccaag
aatttggagctggaggataccgatccaatggtgaatcctccagattccccagagactgaa
tctcctctccagggcagcctgcactcagatggctccagcgggggcagcagtggcaatacc
catgatgactttgttatgatagactttaaaccagctttttctaaagatgacattcttccg
atggacctggggaccttctatcgggagtttcagaacccacctcagctgagcagcctctcc
atagatattggagcacagtccatggctgaagacttggactcattaccagagaagctggct
gtgcatgagaagaatgtccgcgagtttgatgcctttgtggaaaccctgcagtaa

DBGET integrated database retrieval system