KEGG   Homo sapiens (human): 84084Help
Entry
84084             CDS       T01001                                 

Gene name
RAB6C, WTH3
Definition
(RefSeq) RAB6C, member RAS oncogene family
  KO
K07895  Ras-related protein Rab-6C
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84084 (RAB6C)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    84084 (RAB6C)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    84084 (RAB6C)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    84084 (RAB6C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf SRPRB
Motif
Other DBs
NCBI-GeneID: 84084
NCBI-ProteinID: NP_115520
OMIM: 612909
HGNC: 16525
Ensembl: ENSG00000222014
Vega: OTTHUMG00000153487
Pharos: Q9H0N0(Tbio)
UniProt: Q9H0N0
Position
2q21.1
AA seq 254 aa AA seqDB search
MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDG
TIGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
ITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMEST
QDGSREDMSDIKLEKPQEQTVSEGGCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLFPSL
ITFCNSSLLPVSWR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgggcggagacttcgggaatccgctgaggaaattcaagctggtgttcctgggg
gagcaaagcgttgcaaagacatctttgatcaccagattcaggtatgacagttttgacaac
acctatcaggcaataattggcattgactttttatcaaaaactatgtacttggaggatgga
acaatcgggcttcggctgtgggatacggcgggtcaggaacgtctccgtagcctcattccc
aggtacatccgtgattctgctgcagctgtagtagtttacgatatcacaaatgttaactca
ttccagcaaactacaaagtggattgatgatgtcagaacagaaagaggaagtgatgttatc
atcacgctagtaggaaatagaacagatcttgctgacaagaggcaagtgtcagttgaggag
ggagagaggaaagccaaagggctgaatgttacgtttattgaaactagggcaaaagctgga
tacaatgtaaagcagctctttcgacgtgtagcagcagctttgccgggaatggaaagcaca
caggacggaagcagagaagacatgagtgacataaaactggaaaagcctcaggagcaaaca
gtcagcgaagggggttgttcctgctactctcccatgtcatcttcaacccttcctcagaag
cccccttactctttcattgactgcagtgtgaatattggcttgaaccttttcccttcatta
ataacgttttgcaattcatcattgctgcctgtctcgtggaggtga

DBGET integrated database retrieval system