KEGG   Homo sapiens (human): 8409Help
Entry
8409              CDS       T01001                                 

Gene name
UXT, ART-27, STAP1
Definition
(RefSeq) ubiquitously expressed prefoldin like chaperone
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Prefoldin RNase_E_G
Motif
Other DBs
NCBI-GeneID: 8409
NCBI-ProteinID: NP_004173
OMIM: 300234
HGNC: 12641
Ensembl: ENSG00000126756
Vega: OTTHUMG00000021453
Pharos: Q9UBK9(Tbio)
UniProt: Q9UBK9
Position
Xp11.23
AA seq 157 aa AA seqDB search
MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQ
EAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTEL
SNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgccccctaagcggcgggcggtggaggccacgggggagaaagtgctgcgctac
gagaccttcatcagtgacgtgctgcagcgggacttgcgaaaggtgctggaccatcgagac
aaggtatatgagcagctggccaaataccttcaactgagaaatgtcattgagcgactccag
gaagctaagcactcggagttatatatgcaggtggatttgggctgtaacttcttcgttgac
acagtggtcccagatacttcacgcatctatgtggccctgggatatggttttttcctggag
ttgacactggcagaagctctcaagttcattgatcgtaagagctctctcctcacagagctc
agcaacagcctcaccaaggactccatgaatatcaaagcccatatccacatgttgctagag
gggcttagagaactacaaggcctgcagaatttcccagagaagcctcaccattga

DBGET integrated database retrieval system