KEGG   Homo sapiens (human): 84102
Entry
84102             CDS       T01001                                 

Symbol
SLC41A2, SLC41A1-L1
Name
(RefSeq) solute carrier family 41 member 2
  KO
K15122  solute carrier family 41
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    84102 (SLC41A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC41: MgtE-like magnesium transporter
   84102 (SLC41A2)
SSDB
Motif
Pfam: MgtE DUF2278
Other DBs
NCBI-GeneID: 84102
NCBI-ProteinID: NP_115524
OMIM: 610802
HGNC: 31045
Ensembl: ENSG00000136052
Vega: OTTHUMG00000156965
Pharos: Q96JW4(Tdark)
UniProt: Q96JW4
Position
12q23.3
AA seq 573 aa
MTNSKGRSITDKTSGGPSSGGGFVDWTLRLNTIQSDKFLNLLLSMVPVIYQKNQEDRHKK
ANGIWQDGLSTAVQTFSNRSEQHMEYHSFSEQSFHANNGHASSSCSQKYDDYANYNYCDG
RETSETTAMLQDEDISSDGDEDAIVEVTPKLPKESSGIMALQILVPFLLAGFGTVSAGMV
LDIVQHWEVFRKVTEVFILVPALLGLKGNLEMTLASRLSTAVNIGKMDSPIEKWNLIIGN
LALKQVQATVVGFLAAVAAIILGWIPEGKYYLDHSILLCSSSVATAFIASLLQGIIMVGV
IVGSKKTGINPDNVATPIAASFGDLITLAILAWISQGLYSCLETYYYISPLVGVFFLALT
PIWIIIAAKHPATRTVLHSGWEPVITAMVISSIGGLILDTTVSDPNLVGIVVYTPVINGI
GGNLVAIQASRISTYLHLHSIPGELPDEPKGCYYPFRTFFGPGVNNKSAQVLLLLVIPGH
LIFLYTIHLMKSGHTSLTIIFIVVYLFGAVLQVFTLLWIADWMVHHFWRKGKDPDSFSIP
YLTALGDLLGTALLALSFHFLWLIGDRDGDVGD
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgactaatagtaaaggaagatctattaccgataaaacaagtggtggtccaagtagtgga
ggaggttttgtagattggactttacgtttaaacacaattcaatccgacaagtttttaaat
ttactcttgagtatggttccagtgatttaccagaaaaaccaagaagacaggcacaaaaaa
gcaaacggcatttggcaagatggattatcaactgcagtacagacttttagtaatagatct
gagcaacacatggagtatcacagtttctcagagcagtcttttcatgccaataatgggcac
gcatcatcaagctgcagccaaaagtatgatgactatgccaattataattactgtgatgga
agggagacttcagaaaccactgccatgttacaagatgaagatatatctagtgatggtgat
gaagatgctattgtagaagtgaccccaaaattaccaaaggaatccagtggcatcatggca
ttgcaaatacttgtgccctttttgctagctggttttggaacagtttcagctggcatggta
ctggatatagtacagcactgggaggtgttcagaaaagttacagaagttttcattttagtc
cctgcacttcttggtctcaaagggaacttggaaatgacattggcatccagattatccact
gcagtaaatattgggaagatggattcacccattgaaaagtggaacctaataattggcaac
ttggctttaaagcaggttcaggcaacagtagtgggttttctagcagctgtggcagcaatt
atattgggctggattccagaaggaaaatattaccttgatcattccatacttctgtgctct
agcagtgtggcaactgccttcattgcatctcttctgcagggaataataatggttggggtt
atcgttggttcaaagaagactggtataaatcctgataatgttgctacacccattgctgct
agttttggcgaccttataactcttgccatattggcttggataagtcagggcttatactcc
tgtcttgagacctattactacatttctccattagttggtgtatttttcttggctctaacc
cctatttggattataatagctgccaaacatccagccacaagaacagttctccactcaggc
tgggagcctgtcataacagctatggttataagtagcattgggggccttattctggacaca
actgtatcagacccaaacttggttgggattgttgtttacacgccagttattaatggtatt
ggtggtaatttggtggccattcaggctagcaggatttctacctacctccatttacatagc
attccaggagaattgcctgatgaacccaaaggttgttactacccatttagaactttcttt
ggtccaggagtaaataataagtctgctcaagttctactgcttttagtgattcctggacat
ttaattttcctctacactattcatttgatgaaaagtggtcatacttctttaactataatc
ttcatagtagtgtatttatttggcgctgtgttacaggtatttaccttgctgtggattgct
gactggatggtccatcacttctggaggaaaggaaaggacccggatagtttctccatcccc
tacctaacagcattgggtgatctgctcgggacagctctgttagccttaagttttcatttt
ctttggcttattggagatcgagatggagatgttggagactaa

DBGET integrated database retrieval system