KEGG   Homo sapiens (human): 84105
Entry
84105             CDS       T01001                                 
Symbol
PCBD2, DCOH2, DCOHM, PHS2
Name
(RefSeq) pterin-4 alpha-carbinolamine dehydratase 2
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Network
nt06016  Phenylalanine and tyrosine metabolism
  Element
N00705  Tetrahydrobiopterin biosynthesis, BH4OH to BH4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    84105 (PCBD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    84105 (PCBD2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     84105 (PCBD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   84105 (PCBD2)
SSDB
Motif
Pfam: Pterin_4a
Other DBs
NCBI-GeneID: 84105
NCBI-ProteinID: NP_115527
OMIM: 609836
HGNC: 24474
Ensembl: ENSG00000132570
Vega: OTTHUMG00000163070
Pharos: Q9H0N5(Tdark)
UniProt: Q9H0N5
Structure
Position
5:134905131..134962644
AA seq 130 aa
MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDA
IYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA
KFIEKAAASV
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcggcggtgctcggggcgctcggggcgacgcggcgcttgttggcggcgctgcgaggc
cagagcctagggctagcggccatgtcatcaggtactcacaggttgactgcagaggagagg
aaccaagctatacttgaccttaaagcagcaggatggtcggaattaagtgagagagatgcc
atctacaaagaattctccttccacaattttaatcaggcatttggctttatgtcccgagtt
gccctacaagcagagaagatgaatcatcacccagaatggttcaatgtatacaacaaggtc
cagataactctcacctcacatgactgtggtgaactgaccaaaaaagatgtgaagctggcc
aagtttattgaaaaagcagctgcttctgtgtga

DBGET integrated database retrieval system