KEGG   Homo sapiens (human): 84126Help
Entry
84126             CDS       T01001                                 

Gene name
ATRIP
Definition
(RefSeq) ATR interacting protein
  KO
K10905  ATR interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    84126 (ATRIP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    84126 (ATRIP)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    84126 (ATRIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin_1 OmpH HMMR_N Golgin_A5 HIP1_clath_bdg
Motif
Other DBs
NCBI-GeneID: 84126
NCBI-ProteinID: NP_569055
OMIM: 606605
HGNC: 33499
Ensembl: ENSG00000164053
Vega: OTTHUMG00000133532
Pharos: Q8WXE1(Tbio)
UniProt: Q8WXE1 A0A024R2U4
Structure
PDB: 

Position
3p21.31
AA seq 791 aa AA seqDB search
MAGTSAPGSKRRSEPPAPRPGPPPGTGHPPSKRARGFSAAAAPDPDDPFGAHGDFTADDL
EELDTLASQALSQCPAAARDVSSDHKVHRLLDGMSKNPSGKNRETVPIKDNFELEVLQAQ
YKELKEKMKVMEEEVLIKNGEIKILRDSLHQTESVLEEQRRSHFLLEQEKTQALSDKEKE
FSKKLQSLQSELQFKDAEMNELRTKLQTSERANKLAAPSVSHVSPRKNPSVVIKPEACSP
QFGKTSFPTKESFSANMSLPHPCQTESGYKPLVGREDSKPHSLRGDSIKQEEAQKSFVDS
WRQRSNTQGSILINLLLKQPLIPGSSLSLCHLLSSSSESPAGTPLQPPGFGSTLAGMSGL
RTTGSYDGSFSLSALREAQNLAFTGLNLVARNECSRDGDPAEGGRRAFPLCQLPGAVHFL
PLVQFFIGLHCQALQDLAAAKRSGAPGDSPTHSSCVSSGVETNPEDSVCILEGFSVTALS
ILQHLVCHSGAVVSLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLK
MLLHLLAFSSAATGHLQASVLTQCLKVLVKLAENTSCDFLPRFQCVFQVLPKCLSPETPL
PSVLLAVELLSLLADHDQLAPQLCSHSEGCLLLLLYMYITSRPDRVALETQWLQLEQEVV
WLLAKLGVQSPLPPVTGSNCQCNVEVVRALTVMLHRQWLTVRRAGGPPRTDQQRRTVRCL
RDTVLLLHGLSQKDKLFMMHCVEVLHQFDQVMPGVSMLIRGLPDVTDCEEAALDDLCAAE
TDVEDPEVECG
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcggggacctccgcgccaggcagcaagaggcggagcgagcccccggcgcctcgcccc
ggcccgccgccgggcaccgggcaccccccgagcaagcgggcccggggcttctccgcagcc
gctgccccggaccctgacgacccgttcggcgcgcatggggacttcactgccgacgacctg
gaggagcttgacaccctcgcgtcacaggccctgagccaatgtccggccgcggctcgggac
gtgtccagtgatcataaggtccacagattattagatggcatgtcaaaaaatccttcaggg
aaaaacagagaaactgttccaattaaagataatttcgaattagaggtacttcaggcacaa
tacaaagaacttaaagaaaagatgaaagtaatggaagaagaagttctcattaagaatgga
gaaattaaaattttgcgagactcactacatcagacggaatccgttctagaggaacagaga
agatcacattttcttcttgagcaagagaaaacccaagcactcagtgacaaggaaaaggaa
ttctccaaaaagctccaatcattgcagtctgaactccagtttaaagatgcagagatgaat
gaattaaggacaaagctccagaccagtgaacgagcaaataaactggctgctccctctgtt
tcccatgtcagtcctaggaaaaacccttctgtggttataaagccagaagcatgttctcca
caatttggaaaaacatcttttcctacaaaggagtcttttagtgctaacatgtcccttccc
cacccctgccagacggagtcaggatacaagcctctggtgggcagagaggatagtaagccc
cacagtctgagaggtgactccataaaacaagaagaggcccagaaaagctttgttgacagc
tggagacagagatcaaacactcaaggttccattttgataaacctgctcctgaagcagcct
ttgatcccagggtcatccctaagcctttgccacctcctgagtagtagttctgagtctcct
gctggcacccccctgcagccaccagggtttggcagtaccttggctggaatgtcaggcctc
aggaccacaggttcttatgatgggtcattttccctctcagccctgagagaagcacagaac
ctggcattcactggactgaatctggttgcccggaatgagtgctcacgtgatggagaccca
gcagagggaggcagaagggccttcccactctgccagcttcctggagccgtgcatttcctc
ccccttgtacagttcttcatcggcttacactgccaggccctgcaggacttggcagctgct
aagagaagcggagcacctggggactcaccgacacattcctcctgcgtgagctctggggta
gagaccaaccctgaggactcagtgtgcatcctggaaggcttctctgtgactgcacttagc
attcttcagcacctggtgtgccacagcggagcagtcgtctccctattactgtcaggagtg
ggggcagattctgctgctggggaaggaaacaggagcctggttcacaggcttagtgatgga
gatatgacctcagccctaaggggggttgctgatgaccaaggacagcacccactgttgaag
atgcttcttcacctgttggctttctcttctgcagcaacaggtcaccttcaagccagtgtc
ctgacccagtgccttaaggttttggtgaaattagccgaaaacacttcctgtgatttcttg
cccaggttccagtgtgtgttccaagtgctgccaaagtgcctcagcccagagacacccctg
cctagcgtgctgctggctgttgagctcctctccctgctggcggaccacgaccagctggca
cctcagctctgttcccactcagaaggctgcctcctgctgctgctgtacatgtacatcaca
tcacggcctgacagagtggccttggagacacaatggctccagctggaacaagaggtggtg
tggctcctggctaagcttggtgtgcagagccccttgcccccagtcactggctccaactgc
cagtgtaatgtggaggtggtcagagcgctcacggtgatgttgcacagacagtggctgaca
gtgcggagggcagggggacccccaaggaccgaccagcagaggcggacagtgcgctgtctg
cgggacacggtgctgctgctgcacggcctatcgcagaaggacaagctcttcatgatgcac
tgcgtggaggtcctgcatcagtttgaccaggtgatgccgggggtcagcatgctcatccga
gggcttcctgatgtgacggactgtgaagaggcagccctggatgacctctgtgccgcggaa
accgatgtggaagaccccgaggtggagtgtggctga

DBGET integrated database retrieval system