KEGG   Homo sapiens (human): 84128Help
Entry
84128             CDS       T01001                                 

Gene name
WDR75, NET16, UTP17
Definition
(RefSeq) WD repeat domain 75
  KO
K14552  NET1-associated nuclear protein 1 (U3 small nucleolar RNA-associated protein 17)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    84128 (WDR75)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    84128 (WDR75)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    84128 (WDR75)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 84128
NCBI-ProteinID: NP_115544
HGNC: 25725
Ensembl: ENSG00000115368
Vega: OTTHUMG00000132660
Pharos: Q8IWA0(Tdark)
UniProt: Q8IWA0
Position
2q32.2
AA seq 830 aa AA seqDB search
MVEEENIRVVRCGGSELNFRRAVFSADSKYIFCVSGDFVKVYSTVTEECVHILHGHRNLV
TGIQLNPNNHLQLYSCSLDGTIKLWDYIDGILIKTFIVGCKLHALFTLAQAEDSVFVIVN
KEKPDIFQLVSVKLPKSSSQEVEAKELSFVLDYINQSPKCIAFGNEGVYVAAVREFYLSV
YFFKKKTTSRFTLSSSRNKKHAKNNFTCVACHPTEDCIASGHMDGKIRLWRNFYDDKKYT
YTCLHWHHDMVMDLAFSVTGTSLLSGGRESVLVEWRDATEKNKEFLPRLGATIEHISVSP
AGDLFCTSHSDNKIIIIHRNLEASAVIQGLVKDRSIFTGLMIDPRTKALVLNGKPGHLQF
YSLQSDKQLYNLDIIQQEYINDYGLIQIELTKAAFGCFGNWLATVEQRQEKETELELQMK
LWMYNKKTQGFILNTKINMPHEDCITALCFCNAEKSEQPTLVTASKDGYFKVWILTDDSD
IYKKAVGWTCDFVGSYHKYQATNCCFSEDGSLLAVSFEEIVTIWDSVTWELKCTFCQRAG
KIRHLCFGRLTCSKYLLGATENGILCCWNLLSCALEWNAKLNVRVMEPDPNSENIAAISQ
SSVGSDLFVFKPSEPRPLYIQKGISREKVQWGVFVPRDVPESFTSEAYQWLNRSQFYFLT
KSQSLLTFSTKSPEEKLTPTSKQLLAEESLPTTPFYFILGKHRQQQDEKLNETLENELVQ
LPLTENIPAISELLHTPAHVLPSAAFLCSMFVNSLLLSKETKSAKEIPEDVDMEEEKESE
DSDEENDFTEKVQDTSNTGLGEDIIHQLSKSEEKELRKFRKIDYSWIAAL
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggaggagaacatccgcgtggttcgttgtggcggcagcgagttgaactttagg
agagctgtgttctctgcagattctaagtatatcttctgtgtctctggagactttgttaaa
gtttacagcacagttacagaagagtgtgtacacatactgcatggacacagaaatctggtg
actggaatccagcttaaccccaacaaccatctacagctgtattcttgttcccttgatggc
acaattaaactgtgggactatatagatggcatcttaataaagactttcatagttggatgt
aaacttcatgccctctttactcttgcccaagctgaggattctgtctttgttatagtgaat
aaagaaaaaccagatatatttcagctggtttcagtgaaactgccaaaatcctcaagccag
gaagtagaagccaaggagctgtcctttgttttggattacataaaccagtcacccaagtgc
attgcctttggaaacgagggagtatatgttgctgcagtacgggaattttacttgtctgtt
tattttttcaaaaagaaaacaacatcaaggtttactttatcatcatcaagaaataagaag
catgctaaaaacaattttacatgtgtagcatgtcacccaacggaagactgcatcgcatct
ggtcacatggatggcaaaattcgtctttggaggaatttttatgatgataagaaatatacg
tacacatgtttacattggcaccatgatatggttatggatttggctttttcagtgacaggc
accagtctgctgagtggcggtcgtgaatctgtacttgtagagtggcgcgatgcaacagag
aagaataaggagtttctcccgcgtttaggagctactattgaacatatctcagtctcgcct
gcaggagatttattctgcacttctcactctgataataagataataattattcaccgaaac
cttgaagcatccgcagtaattcaaggcctagtgaaagataggagtatcttcactggtttg
atgattgatccaagaactaaagctttggttttgaatggaaaacctggccacctgcagttt
tattctctccagagtgataaacagttatacaatttagatattatacagcaagaatatatt
aatgattatggtctgatccaaattgaactaacaaaggctgcatttggctgctttggtaac
tggcttgcaacagtggaacagcggcaagaaaaggaaactgagcttgaattgcaaatgaaa
ctgtggatgtataataagaaaacacaagggtttattcttaacactaaaattaacatgcca
cacgaagactgcattacagctctctgtttctgtaatgcagaaaaatctgaacagcccacc
ttggttacagctagcaaagatggttacttcaaagtatggatattaacagatgactctgac
atatacaaaaaagctgttggctggacctgtgactttgttggtagttatcacaagtatcaa
gcaactaactgttgtttctccgaagatggttctttactagcagttagttttgaggaaata
gtcacaatatgggattctgtaacatgggaacttaaatgtacattttgccaacgagctggg
aaaataaggcacctttgctttgggagattgacgtgttcaaagtatctacttggtgctact
gaaaatggcattctttgctgttggaatctgctgagctgtgcattggagtggaatgcaaaa
ttaaatgttagagttatggaacccgatcctaattcagagaatattgctgcaatctctcag
tcttcagtgggttcagacttgtttgtatttaaacctagtgagccaaggccattgtatatt
caaaagggtatctccagagagaaagtccagtggggagtgtttgttccacgagatgtccct
gaatccttcacctcagaagcttaccagtggctaaatagatcccagttttacttcctaaca
aaatcacagagtttattgacattcagtacaaagtctccagaagaaaaactcacaccaaca
agcaaacagctgctagcagaagaaagtcttcccacaaccccattttatttcatattggga
aaacacaggcaacagcaggatgaaaaactaaacgaaactttagagaatgagctggtacaa
ctacccttaacagaaaacatacccgcaattagtgagcttcttcacactccagcccatgtc
ctgccatctgctgctttcctgtgctccatgtttgtaaattcattgctgctgtctaaagag
actaagagtgctaaggaaattcctgaagatgtagatatggaagaagaaaaagaaagtgaa
gattcagatgaagaaaatgattttaccgaaaaagtccaggatacaagtaacacaggttta
ggagaagacattatacatcagttgtcaaaatctgaagaaaaagaactgagaaaatttagg
aaaatagactacagctggatagctgccctttaa

DBGET integrated database retrieval system