KEGG   Homo sapiens (human): 84140Help
Entry
84140             CDS       T01001                                 

Gene name
FAM161A, RP28
Definition
(RefSeq) FAM161 centrosomal protein A
  KO
K16772  protein FAM161A
Organism
hsa  Homo sapiens (human)
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84140 (FAM161A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    84140 (FAM161A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0564
Motif
Other DBs
NCBI-GeneID: 84140
NCBI-ProteinID: NP_115556
OMIM: 613596
HGNC: 25808
Ensembl: ENSG00000170264
Vega: OTTHUMG00000152165
Pharos: Q3B820(Tbio)
UniProt: Q3B820
Position
2p15
AA seq 660 aa AA seqDB search
MATSHRVAKLVASSLQTPVNPITGARVAQYEREDPLKALAAAEAILEDEEEEKVAQPAGA
SADLNTSFSGVDEHAPISYEDFVNFPDIHHSNEEYFKKVEELKAAHIETMAKLEKMYQDK
LHLKEVQPVVIREDSLSDSSRSVSEKNSYHPVSLMTSFSEPDLGQSSSLYVSSSEEELPN
LEKEYPRKNRMMTYAKELINNMWTDFCVEDYIRCKDTGFHAAEKRRKKRKEWVPTITVPE
PFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEYKKKFRANPVPASVFLPLYHDLV
KQKEERRRSLKEKSKEALLASQKPFKFIAREEQKRAAREKQLRDFLKYKKKTNRFKARPI
PRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKC
KHKVRCPTPDFEDLPERYQKHLSEHKSPKLLTVCKPFDLHASPHASIKREKILADIEADE
ENLKETRWPYLSPRRKSPVRCAGVNPVPCNCNPPVPTVSSRGREQAVRKSEKERMREYQR
ELEEREEKLKKRPLLFERVAQKNARMAAEKHYSNTLKALGISDEFVSKKGQSGKVLEYFN
NQETKSVTEDKESFNEEEKIEERENGEENYFIDTNSQDSYKEKDEANEESEEEKSVEESH
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcccaccgagtggcgaagctggtggcctccagtctccagaccccggtaaat
cccatcactggagcgcgggtcgcccagtacgaacgcgaagaccccttaaaggccctggcg
gcagcggaggcgatcttggaggacgaagaggaggagaaagtggcgcagcccgctggggca
tcggctgatttgaacaccagcttttctggggtggatgaacatgcaccgataagctatgag
gactttgtgaactttcctgatattcaccactctaatgaggagtatttcaagaaagtagaa
gagttgaaggctgcccacatagaaactatggcaaaattagagaaaatgtaccaggataaa
ttacatttaaaggaagttcagccagtggtcatcagagaagactctcttagtgactcttcc
agatctgtatcagaaaagaactcctatcaccctgtctcattaatgacatcattttcagag
cctgatttaggccagtcttcctccttgtatgtgtcctcctctgaagaggagttacccaac
ctagaaaaagagtatcctaggaaaaacagaatgatgacctatgctaaggagctcatcaac
aatatgtggacagacttttgtgttgaggattatattcgctgtaaagatactggcttccat
gcagctgaaaaaagaaggaagaaacgaaaagaatgggtgcccacaattacagtaccggag
ccttttcaaatgatgataagagaacagaagaaaaaagaagagtccatgaaatctaaatca
gatatcgaaatggtacataaagcgctcaaaaaacaagaagaggatccagagtataagaag
aaattccgagccaatccagttcctgcatctgtctttctccccctttaccatgatttagtc
aagcaaaaagaagaacggagaaggtctctgaaggagaaaagcaaagaagctcttttggcc
tcacaaaagccatttaaatttatagcaagggaggaacagaagcgagcagcccgggaaaag
cagctgagagactttcttaagtataaaaagaaaacaaatcgatttaaagccagacccatt
cctcgatctacttatggttcaactaccaatgacaagttaaaagaagaagagctctatcga
aaccttaggacacagctgagagcccaggagcatttacagaactcatctcctctgccttgt
aggtcagcttgtggatgcaggaaccccaggtgtcctgaacaggctgtaaagttgaagtgt
aaacacaaggttaggtgcccaactcctgattttgaggaccttcctgagagataccagaaa
cacctctcagaacacaagtctccaaaactcttaacagtgtgtaaaccatttgatcttcat
gcatctccacatgcatctattaaaagagaaaaaattttggcagacatcgaagcagatgaa
gaaaatttaaaagaaacacgttggccttatttgtctccaaggcgtaagtcaccagtaaga
tgtgcaggtgtaaaccctgtgccttgtaactgcaaccctcccgtgcccacggtatcttcc
agaggacgagaacaagccgtaagaaagagcgaaaaggaaaggatgagagaataccaacga
gaactagaagaaagagaagaaaaattaaaaaagaggccactgctatttgaaagagttgct
cagaaaaatgcaagaatggcagcagaaaagcattattctaataccctaaaagcactagga
atatctgatgagtttgtttcaaagaaaggccaaagtggaaaagtacttgagtacttcaac
aatcaagagacgaaaagtgtcactgaagacaaagaaagctttaatgaagaagaaaaaata
gaagaaagagagaatggggaagaaaattattttattgataccaacagccaggattcttac
aaggaaaaagatgaagccaatgaggaaagtgaagaagagaaatctgttgaagaatcacac
tga

DBGET integrated database retrieval system