KEGG   Homo sapiens (human): 84152Help
Entry
84152             CDS       T01001                                 

Gene name
PPP1R1B, DARPP-32, DARPP32
Definition
(RefSeq) protein phosphatase 1 regulatory inhibitor subunit 1B
  KO
K15494  protein phosphatase 1 regulatory subunit 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04728  Dopaminergic synapse
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    84152 (PPP1R1B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    84152 (PPP1R1B)
 09160 Human Diseases
  09164 Substance dependence
   05030 Cocaine addiction
    84152 (PPP1R1B)
   05031 Amphetamine addiction
    84152 (PPP1R1B)
   05034 Alcoholism
    84152 (PPP1R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    84152 (PPP1R1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     84152 (PPP1R1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DARPP-32 Cwf_Cwc_15 BSP_II Nop14
Motif
Other DBs
NCBI-GeneID: 84152
NCBI-ProteinID: NP_115568
OMIM: 604399
HGNC: 9287
Ensembl: ENSG00000131771
Vega: OTTHUMG00000133210
Pharos: Q9UD71(Tbio)
UniProt: Q9UD71 B3KVQ9
Position
17q12
AA seq 204 aa AA seqDB search
MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGE
GHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREE
DEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSED
QVEDPALSEPGEEPQRPSPSEPGT
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaccccaaggaccgcaagaagatccagttctcggtgcccgcgccccctagccagctc
gacccccgccaggtggagatgatccggcgcaggagaccaacgcctgccatgctgttccgg
ctctcagagcactcctcaccagaggaggaagcctccccccaccagagagcctcaggagag
gggcaccatctcaagtcgaagagacccaacccctgtgcctacacaccaccttcgctgaaa
gctgtgcagcgcattgctgagtctcacctgcagtctatcagcaatttgaatgagaaccag
gcctcagaggaggaggatgagctgggggagcttcgggagctgggttatccaagagaggaa
gatgaggaggaagaggaggatgatgaagaagaggaagaagaagaggacagccaggctgaa
gtcctgaaggtcatcaggcagtctgctgggcaaaagacaacctgtggccagggtctggaa
gggccctgggagcgcccaccccctctggatgagtccgagagagatggaggctctgaggac
caagtggaagacccagcactaagtgagcctggggaggaacctcagcgcccttccccctct
gagcctggcacatag

DBGET integrated database retrieval system