KEGG   Homo sapiens (human): 84153
Entry
84153             CDS       T01001                                 

Symbol
RNASEH2C, AGS3, AYP1
Name
(RefSeq) ribonuclease H2 subunit C
  KO
K10745  ribonuclease H2 subunit C
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Disease
H00290  Aicardi-Goutieres syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    84153 (RNASEH2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    84153 (RNASEH2C)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    84153 (RNASEH2C)
SSDB
Motif
Pfam: RNase_H2_suC
Other DBs
NCBI-GeneID: 84153
NCBI-ProteinID: NP_115569
OMIM: 610330
HGNC: 24116
Ensembl: ENSG00000172922
Vega: OTTHUMG00000166601
Pharos: Q8TDP1(Tdark)
UniProt: Q8TDP1 A0A024R5B3
Structure
PDB: 
3PUF 3P56

Position
11q13.1
AA seq 164 aa
MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLE
VSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFI
GATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED
NT seq 495 nt   +upstreamnt  +downstreamnt
atggagagcggcgacgaagcggccatcgagaggcaccgcgtccacttgcgctccgccaca
ttgcgcgacgccgtacccgccacactgcatctgctgccctgcgaggttgcggtggacggg
cccgccccggtggggcgcttcttcacgcccgccatccgccagggccccgagggactcgaa
gtgtcgtttcggggccgctgtctacggggagaggaggtggcggtgccgcctggcctcgtg
ggatacgtgatggtgacagaagagaagaaggtgtcgatggggaagccagaccccttgcgg
gattccgggactgacgaccaagaggaggagccgctggagcgggacttcgaccgcttcatt
ggagccactgccaacttcagccgcttcaccctgtggggtctggagaccatccctggcccg
gatgccaaagtgcgtggggccttaacttggcccagccttgcggcagcgattcacgcacag
gtgcccgaggactga

DBGET integrated database retrieval system