KEGG   Homo sapiens (human): 8416
Entry
8416              CDS       T01001                                 

Gene name
ANXA9, ANX31
Definition
(RefSeq) annexin A9
  KO
K17090  annexin A9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    8416 (ANXA9)
SSDB
Motif
Pfam: Annexin T4_tail_cap HTH_34 CUE
Other DBs
NCBI-GeneID: 8416
NCBI-ProteinID: NP_003559
OMIM: 603319
HGNC: 547
Ensembl: ENSG00000143412
Vega: OTTHUMG00000035063
Pharos: O76027(Tbio)
UniProt: O76027
Position
1q21.3
AA seq 345 aa
MSVTGGKMAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVD
RSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQ
ELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLL
ALAKGGRDSYSGIIDYNLAEQDVQALQRAEGPSREETWVPVFTQRNPEHLIRVFDQYQRS
TGQELEEAVQNRFHGDAQVALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISR
CETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgtctgtgactggcgggaagatggcaccgtccctcacccaggagatcctcagccacctg
ggcctggccagcaagactgcagcgtgggggaccctgggcaccctcaggaccttcttgaac
ttcagcgtggacaaggatgcgcagaggctactgagggccattactggccaaggcgtggac
cgcagtgccattgtggacgtgctgaccaaccggagcagagagcaaaggcagctcatctca
cgaaacttccaggagcgcacccaacaggacctgatgaagtctctacaggcagcactttcc
ggcaacctggagaggattgtgatggctctgctgcagcccacagcccagtttgacgcccag
gaattgaggacagctctgaaggcctcagattctgctgtggacgtggccattgaaattctt
gccactcgaaccccaccccagctgcaggagtgcctggcagtctacaaacacaatttccag
gtggaggctgtggatgacatcacatctgagaccagtggcatcttgcaggacctgctgttg
gccctggccaaggggggccgtgacagctactctggaatcattgactataatctggcagaa
caagatgtccaggcactgcagcgggcagaaggacctagcagagaggaaacatgggtccca
gtcttcacccagcgaaatcctgaacacctcatccgagtgtttgatcagtaccagcggagc
actgggcaagagctggaggaggctgtccagaaccgtttccatggagatgctcaggtggct
ctgctcggcctagcttcggtgatcaagaacacaccgctgtactttgctgacaaacttcat
caagccctccaggaaactgagcccaattaccaagtcctgattcgcatccttatctctcga
tgtgagactgaccttctgagtatcagagctgagttcaggaagaaatttgggaagtccctc
tactcttctctccaggatgcagtgaaaggggattgccagtcagccctcctggccttgtgc
agggctgaagacatgtga

DBGET integrated database retrieval system