KEGG   Homo sapiens (human): 84168Help
Entry
84168             CDS       T01001                                 

Gene name
ANTXR1, ATR, GAPO, TEM8
Definition
(RefSeq) ANTXR cell adhesion molecule 1
  KO
K20909  anthrax toxin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Disease
H01482  Infantile hemangioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    84168 (ANTXR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ant_C Anth_Ig VWA VWA_2 VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 84168
NCBI-ProteinID: NP_115584
OMIM: 606410
HGNC: 21014
Ensembl: ENSG00000169604
Vega: OTTHUMG00000129575
Pharos: Q9H6X2(Tbio)
UniProt: Q9H6X2 Q53FL1
Structure
PDB: 

Position
2p13.3
AA seq 564 aa AA seqDB search
MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWN
EIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYM
HEGFERASEQIYYENRQGYRTASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGV
KDFNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVV
VRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMN
DGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVIIKEVPPPPAE
ESEEEDDDGLPKKKWPTVDASYYGGRGVGGIKRMEVRWGEKGSTEEGAKLEKAKNARVKM
PEQEYEFPEPRNLNNNMRRPSSPRKWYSPIKGKLDALWVLLRKGYDRVSVMRPQPGDTGR
CINFTRVKNNQPAKYPLNNAYHTSSPPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTL
PPPPQAPPPNRAPPPSRPPPRPSV
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggccacggcggagcggagagccctcggcatcggcttccagtggctctctttggccact
ctggtgctcatctgcgccgggcaagggggacgcagggaggatgggggtccagcctgctac
ggcggatttgacctgtacttcattttggacaaatcaggaagtgtgctgcaccactggaat
gaaatctattactttgtggaacagttggctcacaaattcatcagcccacagttgagaatg
tcctttattgttttctccacccgaggaacaaccttaatgaaactgacagaagacagagaa
caaatccgtcaaggcctagaagaactccagaaagttctgccaggaggagacacttacatg
catgaaggatttgaaagggccagtgagcagatttattatgaaaacagacaagggtacagg
acagccagcgtcatcattgctttgactgatggagaactccatgaagatctctttttctat
tcagagagggaggctaataggtctcgagatcttggtgcaattgtttactgtgttggtgtg
aaagatttcaatgagacacagctggcccggattgcggacagtaaggatcatgtgtttccc
gtgaatgacggctttcaggctctgcaaggcatcatccactcaattttgaagaagtcctgc
atcgaaattctagcagctgaaccatccaccatatgtgcaggagagtcatttcaagttgtc
gtgagaggaaacggcttccgacatgcccgcaacgtggacagggtcctctgcagcttcaag
atcaatgactcggtcacactcaatgagaagcccttttctgtggaagatacttatttactg
tgtccagcgcctatcttaaaagaagttggcatgaaagctgcactccaggtcagcatgaac
gatggcctctcttttatctccagttctgtcatcatcaccaccacacactgttctgacggt
tccatcctggccatcgccctgctgatcctgttcctgctcctagccctggctctcctctgg
tggttctggcccctctgctgcactgtgattatcaaggaggtccctccaccccctgccgag
gagagtgaggaagaagatgatgatggtctgcctaagaaaaagtggccaacggtagacgcc
tcttattatggtgggagaggcgttggaggcattaaaagaatggaggttcgttggggagaa
aagggctccacagaagaaggtgctaagttggaaaaggcaaagaatgcaagagtcaagatg
ccggagcaggaatatgaattccctgagccgcgaaatctcaacaacaatatgcgtcggcct
tcttccccccggaagtggtactctccaatcaagggaaaactcgatgccttgtgggtccta
ctgaggaaaggatatgatcgtgtgtctgtgatgcgtccacagccaggagacacggggcgc
tgcatcaacttcaccagggtcaagaacaaccagccagccaagtacccactcaacaacgcc
taccacacctcctcgccgcctcctgcccccatctacactcccccacctcctgcgccccac
tgccctcccccgccccccagcgcccctacccctcccatcccgtccccaccttccaccctt
ccccctcctccccaggctccacctcccaacagggcacctcctccctcccgccctcctcca
aggccttctgtctag

DBGET integrated database retrieval system