KEGG   Homo sapiens (human): 8417Help
Entry
8417              CDS       T01001                                 

Gene name
STX7
Definition
(RefSeq) syntaxin 7
  KO
K08488  syntaxin 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    8417 (STX7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    8417 (STX7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8417 (STX7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8417 (STX7)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-Endo
    8417 (STX7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8417 (STX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin_2 SNARE Syntaxin Cep57_CLD_2 Herpes_US9 DASH_Dad4 GAS T3SS_needle_E DUF5329 Prominin Synaptobrevin
Motif
Other DBs
NCBI-GeneID: 8417
NCBI-ProteinID: NP_001313507
OMIM: 603217
HGNC: 11442
Ensembl: ENSG00000079950
Vega: OTTHUMG00000015577
Pharos: O15400(Tbio)
UniProt: O15400
Position
6q23.2
AA seq 261 aa AA seqDB search
MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTN
QLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVA
RVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEA
DIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCI
IILILVIGVAIISLIIWGLNH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacactccaggagttggtggtgaccccgcccagttggcccagaggatctcttct
aacatccagaagatcacacagtgttctgtggaaatacaaagaactctgaatcaacttgga
acacctcaagattcacctgaattgaggcaacagttgcaacagaagcagcagtatactaac
cagcttgccaaagaaacagataagtacattaaagagtttggatctctgcccaccaccccc
agtgaacagcgtcaaaggaaaatacagaaggatcgcttagtggcagagttcacaacatca
ctgacaaacttccagaaggtccagaggcaggctgctgagcgagagaaagagtttgttgct
cgagtaagagccagttccagagtgtctggcagttttcctgaggacagctcaaaagaaagg
aatcttgtatcctgggaaagccaaactcaacctcaagtgcaggtgcaggatgaagaaatt
acagaggatgacctccgtcttattcatgagagagaatcttctatcaggcaacttgaagct
gatattatggatattaatgaaatatttaaagatttgggaatgatgattcatgaacaagga
gatgtaatagatagcatagaagccaatgtggaaaatgcagaggtgcacgttcagcaagca
aatcagcagctgtcaagggcagcagattatcagcgcaaatccagaaaaaccctgtgcatc
atcattcttatccttgtcattggagttgcgattatcagtctcatcatatggggattgaac
cactga

DBGET integrated database retrieval system