KEGG   Homo sapiens (human): 84191
Entry
84191             CDS       T01001                                 
Symbol
CIAO2A, CIA2A, FAM96A
Name
(RefSeq) cytosolic iron-sulfur assembly component 2A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FeS_assembly_P
Other DBs
NCBI-GeneID: 84191
NCBI-ProteinID: NP_115607
OMIM: 618382
HGNC: 26235
Ensembl: ENSG00000166797
Pharos: Q9H5X1(Tdark)
UniProt: Q9H5X1
Structure
Position
15:complement(64072565..64093838)
AA seq 160 aa
MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELE
VVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISE
GTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
NT seq 483 nt   +upstreamnt  +downstreamnt
atgcagcgggtgtccgggctgctctcctggacgctgagcagagtcctgtggctctccggc
ctctctgagccgggagctgcccggcagccccggatcatggaagagaaagcgctagaagtt
tatgatttgattagaactatccgggacccagaaaagcccaatactttagaagaactggaa
gtggtctcggaaagttgtgtggaagttcaggagataaatgaagaagaatatctggttatt
atcaggttcacgccaacagtacctcattgctctttggcgactcttattgggctgtgctta
agagtaaaacttcagcgatgtttaccatttaaacataagttggaaatctacatttctgaa
ggaacccactcaacagaagaagacatcaataagcagataaatgacaaagagcgagtggca
gctgcaatggaaaaccccaacttacgggaaattgtggaacagtgtgtccttgaacctgac
tga

DBGET integrated database retrieval system