KEGG   Homo sapiens (human): 842Help
Entry
842               CDS       T01001                                 

Gene name
CASP9, APAF-3, APAF3, ICE-LAP6, MCH6, PPP1R56
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04370  VEGF signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05016  Huntington disease
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05416  Viral myocarditis
Module
hsa_M00685  Apoptotic machinery
Network
N00098  Intrinsic apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00101  DCC-apoptotic pathway
N00102  Loss of DCC to DCC-apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00262  EBV EBNA3C to intrinsic apoptotic pathway
N00425  HCMV UL36 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00426  HCMV UL37x1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00450  HIV Tat to intrinsic apoptotic pathway
N00451  HIV Tat to intrinsic apoptotic pathway
N00452  HIV Nef to intrinsic apoptotic pathway
N00453  HIV Vpr to intrinsic apoptotic pathway
N00454  HIV Vpr to intrinsic apoptotic pathway
N00474  EBV BHRF1 to intrinsic apoptotic pathway
N00475  EBV BHRF1 to intrinsic apoptotic pathway
N00476  EBV BHRF1 to intrinsic apoptotic pathway
N00477  EBV BHRF1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00478  EBV BARF1 to intrinsic apoptotic pathway
 » show all
Drug target
Rimiducid: D11195
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    842 (CASP9)
   04151 PI3K-Akt signaling pathway
    842 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    842 (CASP9)
   04215 Apoptosis - multiple species
    842 (CASP9)
   04115 p53 signaling pathway
    842 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    842 (CASP9)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    842 (CASP9)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    842 (CASP9)
   05212 Pancreatic cancer
    842 (CASP9)
   05215 Prostate cancer
    842 (CASP9)
   05213 Endometrial cancer
    842 (CASP9)
   05222 Small cell lung cancer
    842 (CASP9)
   05223 Non-small cell lung cancer
    842 (CASP9)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    842 (CASP9)
   05012 Parkinson disease
    842 (CASP9)
   05014 Amyotrophic lateral sclerosis (ALS)
    842 (CASP9)
   05016 Huntington disease
    842 (CASP9)
  09166 Cardiovascular diseases
   05416 Viral myocarditis
    842 (CASP9)
  09171 Infectious diseases: Bacterial
   05134 Legionellosis
    842 (CASP9)
   05152 Tuberculosis
    842 (CASP9)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    842 (CASP9)
   05164 Influenza A
    842 (CASP9)
   05161 Hepatitis B
    842 (CASP9)
   05163 Human cytomegalovirus infection
    842 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    842 (CASP9)
   05169 Epstein-Barr virus infection
    842 (CASP9)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    842 (CASP9)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    842 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    842 (CASP9)
   01002 Peptidases [BR:hsa01002]
    842 (CASP9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     842 (CASP9)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     842 (CASP9)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   842 (CASP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD CARD_2 AsiA
Motif
Other DBs
NCBI-GeneID: 842
NCBI-ProteinID: NP_001220
OMIM: 602234
HGNC: 1511
Ensembl: ENSG00000132906
Vega: OTTHUMG00000002256
Pharos: P55211(Tchem)
UniProt: P55211
Structure
PDB: 

Position
1p36.21
AA seq 416 aa AA seqDB search
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagcggatcggcggctcctgcggcggtgccggctgcggctggtggaagagctg
caggtggaccagctctgggacgccctgctgagccgcgagctgttcaggccccatatgatc
gaggacatccagcgggcaggctctggatctcggcgggatcaggccaggcagctgatcata
gatctggagactcgagggagtcaggctcttcctttgttcatctcctgcttagaggacaca
ggccaggacatgctggcttcgtttctgcgaactaacaggcaagcagcaaagttgtcgaag
ccaaccctagaaaaccttaccccagtggtgctcagaccagagattcgcaaaccagaggtt
ctcagaccggaaacacccagaccagtggacattggttctggaggatttggtgatgtcggt
gctcttgagagtttgaggggaaatgcagatttggcttacatcctgagcatggagccctgt
ggccactgcctcattatcaacaatgtgaacttctgccgtgagtccgggctccgcacccgc
actggctccaacatcgactgtgagaagttgcggcgtcgcttctcctcgctgcatttcatg
gtggaggtgaagggcgacctgactgccaagaaaatggtgctggctttgctggagctggcg
cagcaggaccacggtgctctggactgctgcgtggtggtcattctctctcacggctgtcag
gccagccacctgcagttcccaggggctgtctacggcacagatggatgccctgtgtcggtc
gagaagattgtgaacatcttcaatgggaccagctgccccagcctgggagggaagcccaag
ctctttttcatccaggcctgtggtggggagcagaaagaccatgggtttgaggtggcctcc
acttcccctgaagacgagtcccctggcagtaaccccgagccagatgccaccccgttccag
gaaggtttgaggaccttcgaccagctggacgccatatctagtttgcccacacccagtgac
atctttgtgtcctactctactttcccaggttttgtttcctggagggaccccaagagtggc
tcctggtacgttgagaccctggacgacatctttgagcagtgggctcactctgaagacctg
cagtccctcctgcttagggtcgctaatgctgtttcggtgaaagggatttataaacagatg
cctggttgctttaatttcctccggaaaaaacttttctttaaaacatcataa

DBGET integrated database retrieval system