KEGG   Homo sapiens (human): 84203
Entry
84203             CDS       T01001                                 
Symbol
TXNDC2, SPTRX, SPTRX1
Name
(RefSeq) thioredoxin domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Thioredoxin Glutenin_hmw Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 OST3_OST6
Other DBs
NCBI-GeneID: 84203
NCBI-ProteinID: NP_001091999
OMIM: 617790
HGNC: 16470
Ensembl: ENSG00000168454
UniProt: Q86VQ3 A0A140VJY8
Position
18:9885973..9889275
AA seq 553 aa
MDVDKELGMESVKAGASGKPEMRLGTQEETSEGDANESSLLVLSSNVPLLALEFLEIAQA
KEKAFLPMVSHTFHMRTEESDASQEGDDLPKSSANTSHPKQDDSPKSSEETIQPKEGDIP
KAPEETIQSKKEDLPKSSEKAIQPKESNIPKSSAKPIQPKLGNIPKASVKPSQPKEGDIP
KAPEETIQSKKEDLPKSSEEAIQPKEGDIPKSSAKPIQPKLGNIAKTSVKPSQPKESDIP
KSPEETIQPKEGDIPKSSAKPIQPKLGNIPKASVKPSQPKEGDISKSPEEAIQPKEGDLP
KSLEEAIQPKEGDIPKSPEEAIQPKEGDIPKSLEEAIQPKEGDIPKSPEETIQPKKGDIP
KSPEEAIQPKEGDIPKSPKQAIQPKEGDIPKSLEEAIPPKEIDIPKSPEETIQPKEDDSP
KSLEEATPSKEGDILKPEEETMEFPEGDKVKVILSKEDFEASLKEAGERLVAVDFSATWC
GPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECAIMCVPTFQFYKKEEKVDELCGA
LKEKLEAVIAELK
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggatgtagacaaggaactaggaatggaaagtgttaaagctggagcctctggaaaacca
gaaatgaggctgggcactcaggaagaaacaagtgaaggtgatgctaatgaaagctcatta
ctagtcctgtccagcaacgtgcctctcctggccctagagttcttggaaatagcccaggcc
aaagagaaggcctttctccccatggtcagccacacgttccacatgcgcacagaggagtct
gatgcctcacaggagggcgatgacctacccaagtcctcagcaaacaccagccatcccaag
caggatgacagccccaagtcctcagaagaaaccatccagcccaaggagggtgacatcccc
aaggccccagaagaaaccatccaatccaagaaggaggacctccccaagtcctcagaaaaa
gccatccagcccaaagagagtaacatccccaagtcctcagcaaaacccatccagcccaag
ctgggcaatattcccaaggcctcagtgaagcccagccagcccaaggagggtgacatcccc
aaggccccagaagaaaccatccaatccaagaaggaggacctccccaagtcctcagaagaa
gccatccagcccaaagagggtgacatccccaagtcctcagcaaaacccatccagcccaag
ctgggcaatattgccaagacctcagtgaagcccagccagcccaaggagagtgatatcccc
aagtccccagaagaaaccatccagcccaaggagggtgacatccccaagtcctcagcaaag
cccatccagcccaagctgggcaatattcccaaggcctcagtgaagcccagccagcccaag
gagggtgacatctccaagtccccagaagaagccatccagcccaaggagggtgacctcccc
aagtccctagaggaagccatccagcccaaggagggtgacatccccaagtccccagaagaa
gccatccagcccaaggagggtgacatccccaagtccctagaggaagccatccagcctaag
gagggtgacatccccaagtccccagaagaaaccatccagcccaagaagggtgacatcccc
aagtccccagaagaagccatccagcccaaggagggtgacattcccaagtctccaaaacaa
gccatccagcccaaggagggtgacattcccaagtccctagaggaagccatcccacccaag
gagattgacatccccaagtccccagaagaaaccatccagcccaaggaggatgacagcccc
aagtccctagaagaagccaccccatccaaggagggtgacatcctaaagcctgaagaagaa
acaatggagttcccggagggggacaaggtgaaagtgatcctgagcaaggaggactttgag
gcatcactgaaggaggccggggagaggctggtggctgtggacttctcggccacgtggtgt
gggccctgcaggaccatcagaccattcttccatgccctgtctgtgaagcatgaggatgtg
gtgttcctggaggtggacgctgacaactgtgaggaggtggtgagagagtgcgccatcatg
tgtgtcccaacctttcagttttataaaaaagaagaaaaggtggatgaactttgcggcgcc
cttaaggaaaaacttgaagcagtcattgcagaattaaagtaa

DBGET integrated database retrieval system