KEGG   Homo sapiens (human): 84220Help
Entry
84220             CDS       T01001                                 

Gene name
RGPD5, BS-63, BS63, HEL161, RGP5
Definition
(RefSeq) RANBP2 like and GRIP domain containing 5
  KO
K24044   
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ran_BP1 Rab_bind GRIP TPR_1 TPR_2 TPR_8 TPR_16 TPR_14 TPR_11 TPR_7
Motif
Other DBs
NCBI-GeneID: 84220
NCBI-ProteinID: NP_005045
OMIM: 612708
HGNC: 32418
Ensembl: ENSG00000015568
Vega: OTTHUMG00000130985
Pharos: Q99666(Tdark)
UniProt: Q99666 V9HWE4
Position
2q13
AA seq 1765 aa AA seqDB search
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDP
KAHRFLGLLYELEENTEKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVER
AAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVELYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWQATNTDLLLAYA
NLMLLTLSTRDVQENRELLESFDSALQSAKSSLGGNDELSATFLEMKGHFYMYAGSLLLK
MGQHGNNVQWRALSELAALCYLIAFQVPRPKIKLREGKAGQNLLEMMACDRLSQSGHMLL
SLSRGKQDFLKEVVETFANKIGQSALYDALFSSQSPKDTSFLGSDDIGKIDVQEPELEDL
ARYDVGAIRAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHRLPHETSRLETNAPESI
CILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPFPVCKQLCTERQKSWWDAVCTLI
HRKAVPGNLAKLRLLVQHEINTLRAQEKHGLQPALLVHWAKYLQKTGSGLNSFYGQLEYI
GRSVHYWKKVLPLLKIIKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHITFAMLDAV
NGNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDALSPEEQEECRNYLTKTRDYLIK
IIDDGDSNLSVVKKLPVPLESVKQMLNSVMQELEDYSEGGPLYKNGSLRNADSEIKHSTP
SPTKYSLSPSKSYKYSPETPPRWTEDRNSLLNMICQQVEAIKKEMQELKLNSSKSASRHR
WPTENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
SSNTEFKSTKEGFSIPVSADGFKFGISEPGNQEKKREKPLENDTGFQAQDISGRKKGRGV
IFGQTSSTFTFADVAKSTSGEGFQFGKKDLNFKGFSGAGEKLFSSRYGKMANKANTSGDF
EKDDDAYKTEDSDDIHFEPVVQMPEKVELVTGEEGEKVLYSQGVKLFRFDAEVRQWKERG
LGNLKILKNEVNGKLRMLMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWSASDFSDGD
AKLERLAAKFKTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSG
LKDFKTFLTNDQTKVTEEENKGSGTGAAGASDTTIKPNAENTGPTLEWDNYDLREDALDD
SVSSSSVHASPLASSPVRKNLFRFDESTTGSNFSFKSALSLSKSPAKLNQSGTSVGTDEE
SVVTQEEERDGQYFEPVVPLPDLVEVSSGEENEQVVFSHRAEIYRYDKDVGQWKERGIGD
IKILQNYDNKQVRIVMRRDQVLKLCANHRITPDMSLQNMKGTERVWVWTACDFADGERKV
EHLAVRFKLQDVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPRESPCGKIAVAILEETT
RERTDVIQGDDVADAASEVEVSSTSETTTKAVVSPPKFVFVSESVKRIFSSEKSKPFVFG
NSSATGSLFGFSFNAPLKSNNSETSSVAQSGSESKVEPKKCELSKNSDIEQSSDSKVKNL
SASFPTEESSINYTFKTPEKEPPLWHAEFTKEELVQKLRSTTKSADHLNGLLREIEATNA
VLMEQIKLLKSEIRRLERNQEREKSAANLEYLKNVLLQFIFLKPGSERERLLPVINTMLQ
LSPEEKGKLAAVAQDEEENASRSSG
NT seq 5298 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcagcaaggccgatgtggagcggtacgtcgcctcggtgctgggtctcaccccg
tcgcctcgacagaagtcaatgaaaggattctattttgcaaagctgtattatgaagctaaa
gaatatgatcttgctaaaaaatacatatgtacttacattaatgtgcaagagagggatccc
aaagctcacagatttctgggtcttctttatgaattggaagaaaacacagagaaagccgtt
gaatgttacaggcgttcagtggaattaaacccaacacaaaaagatcttgtgttgaagatt
gcagaattgctttgtaaaaatgatgttactgatggaagagcaaaatactgggtcgaaaga
gcagcaaaacttttcccaggaagtcctgcaatttataaactaaaggaacagcttctagat
tgtgaaggtgaagatggatggaataaactttttgacttgattcagtcagaactttatgta
agacctgatgacgtccatgtgaacatccggctagtggagttgtatcgctcaactaaaaga
ttgaaggatgctgtggcccactgccatgaggcagagaggaacatagctttgcgttcaagt
ttagagtggaattcgtgtgttgtacagacccttaaggaatatctggagtctttacagtgt
ttggagtctgataaaagtgactggcaagcaaccaatacagacttactgctggcctatgct
aatcttatgcttcttacgctttccactagagatgtgcaggaaaatagagaattactggaa
agttttgatagtgctcttcagtctgcgaaatcttctttgggtggaaatgatgaactgtca
gctactttcttagaaatgaaaggacatttctatatgtatgctggttctctgctcttgaag
atgggtcagcatggtaataatgttcaatggcgagctctttctgagctggctgcattgtgc
tatctcatagcatttcaggttccaagaccaaagattaaattaagagaaggtaaagctgga
caaaatctgctggaaatgatggcctgtgaccgactgagccaatcagggcacatgttgcta
agcttaagtcgtggcaagcaagatttcttaaaagaggttgttgaaacttttgccaacaaa
attgggcagtctgcgttatatgatgctctgttttctagtcagtcacctaaggatacatct
tttcttggtagcgatgatattggaaaaattgatgtacaagaaccagagcttgaagatttg
gctagatacgatgttggtgctattcgagcacataatggtagtcttcagcatcttacttgg
cttggcttacagtggaattcattgcctgctttacctggaatccgaaaatggctaaaacag
cttttccatcgtttgccccatgaaacctcaaggcttgaaacaaatgcgcctgaatcaata
tgtattttagatcttgaagtatttctccttggagtagtatataccagccacttacaatta
aaggagaaatgtaattctcaccatagctcctatcagccgttatgcctgccctttcctgtg
tgtaaacagctttgtacagaaagacaaaaatcttggtgggatgcggtttgtactctgatt
cacagaaaagcagtacctggaaacttggcaaaattgagacttctagttcagcatgaaata
aacactctaagagcccaggaaaaacatggccttcaacctgctctgcttgtacattgggca
aaataccttcagaaaacgggcagcggtcttaattctttttatggtcaactagaatacata
gggagaagtgttcattattggaagaaagttttgccattgttgaagataataaagaagaac
agtattcctgaacctattgatcctctgtttaaacattttcatagtgtagacattcaggca
tcagaaattgttgaatatgaagaagacgcacacataacttttgctatgttggatgcagta
aatggaaatatagaagatgctgtgactgcttttgaatctataaaaagtgttgtttcttat
tggaatcttgcactgatttttcacaggaaggcagaagacattgaaaatgatgccctttct
cctgaagaacaagaagaatgcagaaattatctgacaaagaccagggactacctaataaag
attatagatgacggtgattcaaatctttcagtggtcaagaaattgcctgtgcccctggag
tctgtaaaacagatgcttaattcagtcatgcaggaactcgaagactatagtgaaggaggt
cctctctataaaaatggttctttgcgaaatgcagattcagaaataaaacattctacaccg
tctcctaccaaatattcactatcaccaagtaaaagttacaagtattctcccgaaacacca
cctcgatggacagaagatcggaattctttactgaatatgatttgccaacaagtagaggcc
attaagaaagaaatgcaggagttgaaactaaatagcagtaagtcagcatcccgtcatcgt
tggcccacagagaattatggaccagactcggtgcctgatggatatcaggggtcacagaca
tttcatggggctccactaacagttgcaactactggcccttcagtatattatagtcagtca
ccagcatataattcccagtatcttctcagaccagcagctaatgttactcccacaaagggt
tcttctaatacagaatttaagtcaaccaaagaaggattttccatccctgtgtctgctgat
ggatttaaatttggcatttcggaaccaggaaatcaagaaaagaaaagggaaaagcctctt
gaaaatgatactggcttccaggctcaggatattagtggccggaagaagggccgtggtgtg
atttttggccaaacaagtagcacttttacatttgcagatgttgcaaaatcaacttcagga
gaaggatttcagtttggcaaaaaagacctcaatttcaagggattttcaggtgctggagaa
aaattattctcatcacgatacggtaaaatggccaataaagcaaacacttccggtgacttt
gagaaagatgatgatgcctataagactgaggacagcgatgacatccattttgaaccagta
gttcaaatgcctgaaaaagtagaacttgtaacaggagaagaaggtgaaaaagttctgtat
tcacagggggtaaaactatttagatttgatgctgaggtaaggcagtggaaagaaaggggc
ttggggaacttaaaaattctcaaaaacgaggtcaatggcaaactaagaatgctgatgcga
agagaacaagtactaaaagtgtgtgctaatcattggataacgactacaatgaacctgaag
cccctctctggatcagatagagcatggatgtggtcagccagtgatttctctgacggtgat
gccaaactagagcggttggcagcaaaatttaaaacaccagagctggctgaagaattcaag
cagaaatttgaggaatgccagcggcttctgttagacataccacttcaaactccccataaa
cttgtagatactggcagagctgccaagttaatacagagagctgaagaaatgaagagtgga
ctgaaagatttcaaaacatttttgacaaatgatcaaacaaaagtcactgaggaagaaaat
aagggttcaggtacaggtgcggccggtgcctcagacacaacaataaaacccaatgctgaa
aacactgggcccacattagaatgggataactatgacttaagggaagatgctttggatgat
agtgtcagtagtagctcagtacatgcttctccattggcaagtagccctgtgagaaaaaat
cttttccgctttgatgagtcaacaacaggatctaacttcagttttaaatctgctttgagt
ctatctaagtctcctgccaagttgaatcagagtgggacttcagttggcactgatgaagaa
tctgttgttactcaagaagaagagagagatggacagtactttgaacctgttgttccttta
cctgatctagttgaagtatccagtggtgaggaaaatgaacaagttgtttttagtcacagg
gcagaaatctacagatatgataaagatgttggtcaatggaaagaaaggggcattggtgat
ataaagattttacagaattatgataataagcaagttcgtatagtgatgagaagggaccaa
gtattaaaactttgtgccaatcacagaataactccagacatgagtttgcaaaatatgaaa
gggacagaaagagtatgggtgtggactgcatgtgattttgcagatggagaaagaaaagta
gagcatttagctgttcgttttaaactacaggatgttgcagactcgtttaagaaaattttt
gatgaagcaaaaacagcccaggaaaaagattctttgataacacctcatgtttctcggtca
agcactcccagagagtcaccatgtggcaaaattgctgtagctatattagaagaaaccaca
agagagaggacagatgttattcagggtgatgatgtagcagatgcagcttcagaagttgaa
gtgtctagcacatctgaaacaacaacaaaagcagtggtttctcctccaaagtttgtattt
gtttcagagtctgttaaaagaatttttagtagtgaaaaatcaaaaccatttgtatttggc
aacagttctgccactgggtctttgtttggatttagttttaatgcacctttgaaaagtaac
aatagtgaaactagttcagtagcccagagtggatctgaaagcaaagtggaacctaaaaaa
tgtgaactgtcaaagaactctgatatcgaacagtcttcagatagcaaagtcaaaaatctc
tctgcttcctttccaacggaagaatcttcaatcaactacacatttaaaacaccagaaaag
gagcctccattatggcatgctgaatttaccaaagaagaattggttcagaagctccgttcc
accacaaaaagtgcagatcacttaaacggcctgcttcgggaaatagaggcaaccaatgca
gtccttatggagcaaattaagcttctcaaaagtgaaataagaagattggaaaggaatcaa
gagcgagagaagtctgcagctaacctggaatacttgaagaacgtcttgctgcagttcatt
ttcttgaagccaggtagtgaaagagagagacttcttcctgttataaatacgatgttgcag
ctcagccctgaagaaaagggaaaacttgctgcggttgctcaagatgaggaagaaaatgct
tcccgttcttctggatga

DBGET integrated database retrieval system