KEGG   Homo sapiens (human): 84221Help
Entry
84221             CDS       T01001                                 

Gene name
SPATC1L, C21orf56
Definition
(RefSeq) spermatogenesis and centriole associated 1 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Speriolin_C Speriolin_N
Motif
Other DBs
NCBI-GeneID: 84221
NCBI-ProteinID: NP_001136326
OMIM: 612412
HGNC: 1298
Ensembl: ENSG00000160284
Vega: OTTHUMG00000090487
Pharos: Q9H0A9(Tdark)
UniProt: Q9H0A9
Position
21q22.3
AA seq 340 aa AA seqDB search
MAEGGELMSRLLSENADLKKQVRLLKENQMLRRLLSQSCQEGGGHDLLPPRAHAYPEAGS
PGSGVPDFGRFTSVADTPSQLQTSSLEDLLCSHAPLSSEDDTSPGCAAPSQAPFKAFLSP
PEPHSHRGTDRKLSPLLSPLQDSLVDKTLLEPREMVRPKKVCFSESSLPTGDRTRRSYYL
NEIQSFAGAEKDARVVGEIAFQLDRRILAYVFPGVTRLYGFTVANIPEKIEQTSTKSLDG
SVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSP
AALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLFAW
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggcggcgagctgatgagccggctcctgagcgagaacgcggacctgaagaag
caggtgcgcctcctgaaggagaatcagatgctgcggcggctgctcagccagagctgccag
gagggcggcggccacgacctgctcccacccagggcgcatgcctaccctgaggccggctcc
cccgggagcggagttccagatttcggaaggttcacgagtgttgccgacacgccctcccaa
ctgcagacatcctccctggaggacctgctgtgctcacatgcccccctgtccagcgaggac
gacacctccccgggctgtgcagccccctcccaggcacccttcaaggccttcctcagtccc
ccagagccacatagccaccgaggcaccgacaggaagctgtccccgctcctgagccccttg
caagactcactggtggacaagaccctgctggagcccagggagatggtccggcctaagaag
gtgtgtttctcggagagcagcctgcccaccggggacaggaccaggaggagctactacctc
aatgagatccagagcttcgcgggcgccgagaaggacgcgcgcgtggtgggcgagatcgcc
ttccagctggaccgccgcatcctggcctacgtgttcccgggcgtgacgcggctctacggc
ttcacggtggccaacatccccgagaagatcgagcagacctccaccaagtctctggacggc
tccgtggacgagaggaagctgcgcgagctgacgcagcgctacctggccctgagcgcgcgc
ctggagaagctgggctacagccgcgacgtgcacccggcgttcagcgagttcctcatcaac
acctacggaatcctgaagcagcggcccgacctgcgcgccaaccccctgcacagcagcccg
gccgcgctgcgcaagctggtcatcgacgtggtgccccccaagttcctgggcgactcgctg
ctgctgctcaactgcctgtgcgagctctccaaggaggacggcaagcccctcttcgcctgg
tga

DBGET integrated database retrieval system