KEGG   Homo sapiens (human): 84224
Entry
84224             CDS       T01001                                 
Symbol
NBPF3, AE2
Name
(RefSeq) NBPF member 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Olduvai GAT
Other DBs
NCBI-GeneID: 84224
NCBI-ProteinID: NP_115640
OMIM: 612992
HGNC: 25076
Ensembl: ENSG00000142794
UniProt: Q9H094
Position
1:21436789..21484900
AA seq 633 aa
MPLTPTVQGFQWTLRGPDVETSPFGAPRAASHGVGRHQELRDPTVPGPTSSATNVSMVVS
AGPWSGEKAEMNILEINKKSRPQLAENKQQFRNLKQKCLVTQVAYFLANRQNNYDYEDCK
DLIKSMLRDERLLTEEKLAEELGQAEELRQYKVLVHSQERELTQLREKLQEGRDASRSLN
QHLQALLTPDEPDNSQGRDLREQLAEGCRLAQHLVQKLSPENDDDEDEDVKVEEAEKVQE
LYAPREVQKAEEKEVPEDSLEECAITCSNSHHPCESNQPYGNTRITFEEDQVDSTLIDSS
SHDEWLDAVCIIPENESDHEQEEEKGPVSPRNLQESEEEEAPQESWDEGDWTLSIPPDMS
ASYQSDRSTFHSVEEQQVGLALDIGRHWCDQVKKEDQEATSPRLSRELLDEKEPEVLQDS
LDRFYSTPFEYLELPDLCQPYRSDFYSLQEQHLGLALDLDRMKKDQEEEEDQGPPCPRLS
RELPEVVEPEDLQDSLDRWYSTPFSYPELPDSCQPYGSCFYSLEEEHVGFSLDVDEIEKY
QEGEEDQKPPCPRLNEVLMEAEEPEVLQDSLDRCYSTTSTYFQLHASFQQYRSAFYSFEE
QDVSLALDVDNRFFTLTVIRHHLAFQMGVIFPH
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgccactgactcccactgtccagggcttccagtggactctccgaggccctgatgtagaa
acttccccattcggtgcaccaagagcagcctcacatggtgtgggccgacatcaagagctg
cgagatccaacagtccctggccccacctcttctgccacaaacgtcagcatggtggtatct
gccggcccttggtccggtgagaaggcagagatgaacattctagaaatcaacaagaaatcg
cgcccccagctggcagagaacaaacagcagttcagaaacctcaaacagaaatgtcttgta
actcaagtggcctacttcctggccaaccggcaaaataattacgactatgaagactgcaaa
gacctcataaaatctatgctgagggatgagcggctgctcacagaagagaagcttgcagag
gagctcgggcaagctgaggagctcaggcaatataaagtcctggttcactctcaggaacga
gagctgacccagttaagggagaagttacaggaagggagagatgcctcccgctcattgaat
cagcatctccaggccctcctcactccggatgagccggacaactcccagggacgggacctc
cgagaacagctggctgagggatgtaggctggcacagcacctcgtccaaaagctcagccca
gaaaatgatgacgatgaggatgaagatgttaaagttgaggaggctgagaaagtacaggaa
ttatatgcccccagggaggtgcagaaggctgaagaaaaggaagtccctgaggactcactg
gaggagtgtgccatcacttgttcaaatagccaccacccttgtgagtccaaccagccttac
gggaacaccagaatcacatttgaggaagaccaagtcgactcaactctcattgactcatcc
tctcatgatgaatggttggatgctgtatgcattatcccagaaaatgaaagtgatcatgag
caagaggaagaaaaagggccagtgtctcccaggaatctgcaggagtctgaagaggaggaa
gccccccaggagtcctgggatgaaggtgattggactctctcaattcctcctgacatgtct
gcctcataccagtctgacaggagcacctttcactcagtagaggaacagcaagtcggcttg
gctcttgacataggcagacattggtgtgatcaagtgaaaaaggaggaccaagaggccaca
agtcccaggctcagcagggagctgctggatgagaaagagcctgaagtcttgcaggactca
ctggatagattttattcaactccttttgagtacctggaactgcctgacttatgccagccc
tacagaagtgacttttactcattgcaggaacaacaccttggcttggctcttgacttggac
agaatgaaaaaggaccaagaagaggaagaagaccaaggcccaccatgccccaggctcagc
agagagctgccggaggtagtagagcctgaggacttgcaggactcactggatagatggtat
tcgactcctttcagttatccagaactgcctgattcatgccagccctacggaagttgcttt
tactcattggaggaagaacacgttggcttttctcttgacgtggatgaaattgaaaagtac
caagaaggggaagaagatcaaaagccaccatgccccaggctcaacgaggtgctgatggaa
gcagaagagcctgaagtcttgcaggactcactggatagatgttattcgactacttcaact
tactttcaactacatgcctcattccagcagtatagaagtgccttttactcatttgaggaa
caggacgtcagcttggcccttgacgtggacaataggttttttactttgacagtgataagg
caccacctggccttccagatgggagtcatattcccacactaa

DBGET integrated database retrieval system