KEGG   Homo sapiens (human): 84229Help
Entry
84229             CDS       T01001                                 

Gene name
DRC7, C16orf50, CCDC135, CFAP50, FAP50
Definition
(RefSeq) dynein regulatory complex subunit 7
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_core
Motif
Other DBs
NCBI-GeneID: 84229
NCBI-ProteinID: NP_001276091
HGNC: 25289
Ensembl: ENSG00000159625
Vega: OTTHUMG00000133473
Pharos: Q8IY82(Tdark)
UniProt: Q8IY82
Position
16q21
AA seq 874 aa AA seqDB search
MEVLREKVEEEEEAEREEAAEWAEWARMEKMMRPVEVRKEEITLKQETLRDLEKKLSEIQ
ITVSAELPAFTKDTIDISKLPISYKTNTPKEEHLLQVADNFSRQYSHLCPDRVPLFLHPL
NECEVPKFVSTTLRPTLMPYPELYNWDSCAQFVSDFLTMVPLPDPLKPPSHLYSSTTVLK
YQKGNCFDFSTLLCSMLIGSGYDAYCVNGYGSLDLCHMDLTREVCPLTVKPKETIKKEEK
VLPKKYTIKPPRDLCSRFEQEQEVKKQQEIRAQEKKRLREEEERLMEAEKAKPDALHGLR
VHSWVLVLSGKREVPENFFIDPFTGHSYSTQDEHFLGIESLWNHKNYWINMQDCWNCCKD
LIFDLGDPVRWEYMLLGTDKSQLSLTEEDDSGINDEDDVENLGKEDEDKSFDMPHSWVEQ
IEISPEAFETRCPNGKKVIQYKRAKLEKWAPYLNSNGLVSRLTTYEDLQCTNILEIKEWY
QNREDMLELKHINKTTDLKTDYFKPGHPQALRVHSYKSMQPEMDRVIEFYETARVDGLMK
REETPRTMTEYYQGRPDFLSYRHASFGPRVKKLTLSSAESNPRPIVKITERFFRNPAKPA
EEDVAERVFLVAEERIQLRYHCREDHITASKREFLRRTEVDSKGNKIIMTPDMCISFEVE
PMEHTKKLLYQYEAMMHLKREEKLSRHQVWESELEVLEILKLREEEEAAHTLTISIYDTK
RNEKSKEYREAMERMMHEEHLRQVETQLDYLAPFLAQLPPGEKLTCWQAVRLKDECLSDF
KQRLINKANLIQARFEKETQELQKKQQWYQENQVTLTPEDEDLYLSYCSQAMFRIRILEQ
RLNRHKELAPLKYLALEEKLYKDPRLGELQKIFA
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcctgagggagaaggtggaggaggaggaggaggccgagcgggaggaggcggcc
gagtgggctgaatgggcgaggatggagaaaatgatgaggccagttgaggtgcggaaggag
gaaatcaccttaaagcaggagacgctcagagacctggagaagaagctgtcagagatccag
atcactgtctcagcggagctcccggcctttaccaaggacactattgacatctccaagctg
cccatttcctacaaaaccaacacacccaaggaggaacacctgctgcaggtggcagacaac
ttctcccgccagtacagccatctgtgcccggaccgcgtgcccctcttcctgcaccccctg
aacgagtgtgaagtgcccaagttcgtgagcacaaccctccggcccacactgatgccctac
cccgagctctacaactgggacagctgtgcccagtttgtctccgacttcctcaccatggtg
cccctgcctgaccctctcaagccgccctcgcacctgtactcctcgaccactgtgctcaag
taccagaaggggaactgctttgacttcagtacgctgctctgctccatgcttatcggctct
ggctatgatgcttactgcgtcaacggctacggctcgctggacctgtgccacatggacctg
acgcgggaggtgtgcccactcactgtgaagcccaaggagaccatcaagaaggaggaaaag
gtgctgcctaagaagtataccatcaaaccccccagggacctgtgcagcaggtttgagcag
gagcaagaggtgaagaagcagcaggagatcagagcccaggagaagaagcggctgagggag
gaggaggagcgcctcatggaagcggagaaggcaaagccggatgccctgcacggcctgcgg
gtgcactcctgggtccttgtgctatcggggaagcgcgaggtgcctgagaacttcttcatc
gacccattcacaggacatagctacagcacccaggatgagcacttcctgggcatcgaaagc
ctgtggaaccacaagaactactggatcaacatgcaggattgctggaactgctgcaaggac
ttgatctttgacctgggtgaccctgtgagatgggagtacatgctcctggggactgataag
tctcagctgtccttgactgaagaagacgacagtgggataaacgatgaggatgatgtggaa
aatctgggcaaggaggatgaggataagagcttcgacatgccccactcgtgggtggagcag
attgagatctccccggaagcatttgagacccgctgcccgaacgggaagaaggtgattcag
tacaagagggcaaagctggagaagtgggccccgtacctcaatagcaatggccttgtgagc
cgcctcaccacctatgaggacttgcagtgtaccaatattttggagataaaggagtggtac
cagaaccgggaagacatgctggagctgaaacacataaacaagaccacagacctgaagaca
gactacttcaagcctggccacccccaggctctgcgcgtgcactcgtacaagtccatgcaa
cctgagatggaccgtgtcattgagttttatgaaacggcccgtgtggatggcctgatgaag
cgggaggagacacccaggacaatgacagagtactatcaaggacgcccagacttcctctcc
taccgccatgccagcttcggaccccgagtcaagaagctcactctgagcagtgcagagtca
aacccccggcccattgtgaaaatcacagagcggttcttccgcaacccagcgaagcccgcg
gaggaggacgtggcagagcgcgtgtttctggtcgcggaggagcgcatccagctgcgctac
cactgccgtgaggaccacatcacggcctccaagcgcgagttcctgcggcgcaccgaggtg
gacagcaaaggcaacaagatcatcatgacgcccgacatgtgcatcagcttcgaggtggag
cccatggagcacaccaagaagctgctctaccagtacgaggccatgatgcacctgaagagg
gaggagaagctgtccagacatcaggtctgggagtcagagctggaggtgctggagattctg
aagcttcgagaggaagaggaggcggcgcacacactgaccatctccatctatgacaccaag
cggaatgagaagagcaaggaatatcgggaggccatggagcgcatgatgcacgaagagcac
ctgcggcaggtggagacccagctggactacctggccccattcctggcccagctcccgcca
ggagagaaactaacatgctggcaggcggtgcgcctcaaggatgagtgcctcagcgacttc
aagcagcggctcatcaacaaggccaacctcatccaggcccgctttgagaaggagacccag
gagctgcaaaagaagcagcagtggtaccaggagaaccaggtgacgctgacacccgaggat
gaagacctgtacctgagttactgctctcaggccatgttccgcatccgcatcctggagcag
cgcctcaatcgacacaaggaactggccccactgaagtacctggctctggaggaaaagctc
tacaaggacccacgcctgggggagctccagaaaatattcgcttga

DBGET integrated database retrieval system